BLASTX nr result
ID: Dioscorea21_contig00011589
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011589 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger ... 55 6e-06 ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containin... 55 6e-06 >ref|XP_004164844.1| PREDICTED: LOW QUALITY PROTEIN: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1475 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 3 DPHMDPGYESAEE-EPDDKRRDTYLRSRESSSLRKAREAGYLGKGGSS-NSTWN-ERKVS 173 DP+MDP +ES +E E DDKRR+TY SR +S R+ RE GKGGS N +W+ R S Sbjct: 735 DPNMDPSHESEDEDEADDKRRETYTLSRSTSFGRRTREPVSPGKGGSHLNDSWSGTRNFS 794 Query: 174 ETSSEQA 194 T+ + + Sbjct: 795 NTNRDMS 801 >ref|XP_004148557.1| PREDICTED: zinc finger CCCH domain-containing protein 19-like [Cucumis sativus] Length = 1470 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/67 (47%), Positives = 43/67 (64%), Gaps = 3/67 (4%) Frame = +3 Query: 3 DPHMDPGYESAEE-EPDDKRRDTYLRSRESSSLRKAREAGYLGKGGSS-NSTWN-ERKVS 173 DP+MDP +ES +E E DDKRR+TY SR +S R+ RE GKGGS N +W+ R S Sbjct: 735 DPNMDPSHESEDEDEADDKRRETYTLSRSTSFGRRTREPVSPGKGGSHLNDSWSGTRNFS 794 Query: 174 ETSSEQA 194 T+ + + Sbjct: 795 NTNRDMS 801