BLASTX nr result
ID: Dioscorea21_contig00011584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011584 (392 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532038.1| conserved hypothetical protein [Ricinus comm... 57 2e-06 ref|XP_002302041.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 emb|CBI23654.3| unnamed protein product [Vitis vinifera] 55 4e-06 gb|AFG65883.1| Pinus taeda anonymous locus 2_8751_01 genomic seq... 55 8e-06 ref|NP_001145392.1| uncharacterized protein LOC100278742 [Zea ma... 55 8e-06 >ref|XP_002532038.1| conserved hypothetical protein [Ricinus communis] gi|223528308|gb|EEF30354.1| conserved hypothetical protein [Ricinus communis] Length = 169 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = +3 Query: 291 TSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNH 392 +SS P+ +SS PSRYE+QKRRDWNTFGQYLKNH Sbjct: 36 SSSSPS--SSSTPSRYENQKRRDWNTFGQYLKNH 67 >ref|XP_002302041.1| predicted protein [Populus trichocarpa] gi|222843767|gb|EEE81314.1| predicted protein [Populus trichocarpa] Length = 149 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/36 (66%), Positives = 29/36 (80%) Frame = +3 Query: 285 MMTSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNH 392 M S+ + +S+ PSRYE+QKRRDWNTFGQYLKNH Sbjct: 1 MSVSNSSSPSSSTAPSRYENQKRRDWNTFGQYLKNH 36 >emb|CBI23654.3| unnamed protein product [Vitis vinifera] Length = 103 Score = 55.5 bits (132), Expect = 4e-06 Identities = 23/33 (69%), Positives = 28/33 (84%) Frame = +3 Query: 294 SSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNH 392 +S + +SS PSRYE+QKRRDWNTFGQYL+NH Sbjct: 21 ASSSSSPSSSTPSRYENQKRRDWNTFGQYLRNH 53 >gb|AFG65883.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165944|gb|AFG65884.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165945|gb|AFG65885.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165946|gb|AFG65886.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165947|gb|AFG65887.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165948|gb|AFG65888.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165949|gb|AFG65889.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165950|gb|AFG65890.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165951|gb|AFG65891.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165952|gb|AFG65892.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165953|gb|AFG65893.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165954|gb|AFG65894.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165955|gb|AFG65895.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165956|gb|AFG65896.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165957|gb|AFG65897.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165958|gb|AFG65898.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165959|gb|AFG65899.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence gi|383165960|gb|AFG65900.1| Pinus taeda anonymous locus 2_8751_01 genomic sequence Length = 134 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/34 (67%), Positives = 28/34 (82%) Frame = +3 Query: 291 TSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNH 392 ++ + + S+ PSRYESQKRRDWNTFGQYLKNH Sbjct: 22 SNGRESREPSTVPSRYESQKRRDWNTFGQYLKNH 55 >ref|NP_001145392.1| uncharacterized protein LOC100278742 [Zea mays] gi|195655519|gb|ACG47227.1| hypothetical protein [Zea mays] gi|413937846|gb|AFW72397.1| putative protein of unknown function (DUF640) domain family protein [Zea mays] Length = 204 Score = 54.7 bits (130), Expect = 8e-06 Identities = 23/34 (67%), Positives = 26/34 (76%) Frame = +3 Query: 291 TSSEPNMDNSSRPSRYESQKRRDWNTFGQYLKNH 392 +SS P PSRYE+QKRRDWNTFGQYL+NH Sbjct: 30 SSSAPGGGTPQTPSRYEAQKRRDWNTFGQYLRNH 63