BLASTX nr result
ID: Dioscorea21_contig00011475
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011475 (318 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] 106 2e-21 ref|NP_172414.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] gi... 103 1e-20 ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain ... 103 1e-20 ref|XP_002889749.1| ATP-citrate lyase A-3 [Arabidopsis lyrata su... 103 1e-20 ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain ... 103 1e-20 >gb|AFB82642.1| ATP-citrate synthase [Camellia sinensis] Length = 423 Score = 106 bits (264), Expect = 2e-21 Identities = 48/52 (92%), Positives = 52/52 (100%) Frame = -1 Query: 318 HIYVRRGGPNYQTGLAKMRALGKELGIPLEVYGPEATMTGICKEAIDCIMAA 163 HIYVRRGGPNYQTGLAKMRALG+ELG+PLEVYGPEATMTGICK+AIDCIM+A Sbjct: 371 HIYVRRGGPNYQTGLAKMRALGEELGVPLEVYGPEATMTGICKQAIDCIMSA 422 >ref|NP_172414.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] gi|75099788|sp|O80526.1|ACLA3_ARATH RecName: Full=ATP-citrate synthase alpha chain protein 3; Short=ATP-citrate synthase A-3; AltName: Full=ATP-citrate lyase A-3; AltName: Full=Citrate cleavage enzyme A-3 gi|3482918|gb|AAC33203.1| Similar to ATP-citrate-lyase [Arabidopsis thaliana] gi|22022573|gb|AAM83243.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gi|27764922|gb|AAO23582.1| At1g09430/F19J9_9 [Arabidopsis thaliana] gi|332190321|gb|AEE28442.1| ATP-citrate lyase A-3 [Arabidopsis thaliana] Length = 424 Score = 103 bits (258), Expect = 1e-20 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -1 Query: 318 HIYVRRGGPNYQTGLAKMRALGKELGIPLEVYGPEATMTGICKEAIDCIMAAD 160 HIYVRRGGPNYQTGLA+MRALG+ELG+PLEVYGPEATMTGICK AIDCIM D Sbjct: 371 HIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423 >ref|XP_003633614.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 2 [Vitis vinifera] Length = 435 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -1 Query: 318 HIYVRRGGPNYQTGLAKMRALGKELGIPLEVYGPEATMTGICKEAIDCIMA 166 HIYVRRGGPNYQTGLA+MRALG+ELGIPLEVYGPEATMTGICK+AIDCIM+ Sbjct: 383 HIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 433 >ref|XP_002889749.1| ATP-citrate lyase A-3 [Arabidopsis lyrata subsp. lyrata] gi|297335591|gb|EFH66008.1| ATP-citrate lyase A-3 [Arabidopsis lyrata subsp. lyrata] Length = 424 Score = 103 bits (258), Expect = 1e-20 Identities = 47/53 (88%), Positives = 50/53 (94%) Frame = -1 Query: 318 HIYVRRGGPNYQTGLAKMRALGKELGIPLEVYGPEATMTGICKEAIDCIMAAD 160 HIYVRRGGPNYQTGLA+MRALG+ELG+PLEVYGPEATMTGICK AIDCIM D Sbjct: 371 HIYVRRGGPNYQTGLARMRALGEELGVPLEVYGPEATMTGICKRAIDCIMLPD 423 >ref|XP_002280514.1| PREDICTED: ATP-citrate synthase alpha chain protein 2 isoform 1 [Vitis vinifera] gi|296089834|emb|CBI39653.3| unnamed protein product [Vitis vinifera] Length = 423 Score = 103 bits (258), Expect = 1e-20 Identities = 47/51 (92%), Positives = 51/51 (100%) Frame = -1 Query: 318 HIYVRRGGPNYQTGLAKMRALGKELGIPLEVYGPEATMTGICKEAIDCIMA 166 HIYVRRGGPNYQTGLA+MRALG+ELGIPLEVYGPEATMTGICK+AIDCIM+ Sbjct: 371 HIYVRRGGPNYQTGLARMRALGEELGIPLEVYGPEATMTGICKQAIDCIMS 421