BLASTX nr result
ID: Dioscorea21_contig00011467
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011467 (542 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003544286.1| PREDICTED: lon protease 2-like [Glycine max] 116 2e-24 ref|XP_004147846.1| PREDICTED: lon protease 2-like [Cucumis sati... 116 3e-24 dbj|BAJ53168.1| JHL18I08.2 [Jatropha curcas] 116 3e-24 ref|XP_002510457.1| ATP-dependent peptidase, putative [Ricinus c... 116 3e-24 ref|NP_177679.1| ATP-dependent protease La domain-containing pro... 115 6e-24 >ref|XP_003544286.1| PREDICTED: lon protease 2-like [Glycine max] Length = 272 Score = 116 bits (291), Expect = 2e-24 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERDTLRNTLNYLTAASAVKDAF 182 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTA RLKRE+DTL+NTLNYLTAASAVKDAF Sbjct: 209 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTATRLKREKDTLKNTLNYLTAASAVKDAF 268 >ref|XP_004147846.1| PREDICTED: lon protease 2-like [Cucumis sativus] gi|449521473|ref|XP_004167754.1| PREDICTED: lon protease 2-like [Cucumis sativus] Length = 290 Score = 116 bits (290), Expect = 3e-24 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERDTLRNTLNYLTAASAVKDAF 182 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRE++TLRNTLNYLTAASAVKD F Sbjct: 227 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKREKETLRNTLNYLTAASAVKDVF 286 >dbj|BAJ53168.1| JHL18I08.2 [Jatropha curcas] Length = 278 Score = 116 bits (290), Expect = 3e-24 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERDTLRNTLNYLTAASAVKDAF 182 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRE++TLRNTLNYLTAASAVKD F Sbjct: 216 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKREKETLRNTLNYLTAASAVKDVF 275 >ref|XP_002510457.1| ATP-dependent peptidase, putative [Ricinus communis] gi|223551158|gb|EEF52644.1| ATP-dependent peptidase, putative [Ricinus communis] Length = 283 Score = 116 bits (290), Expect = 3e-24 Identities = 57/60 (95%), Positives = 59/60 (98%) Frame = +3 Query: 3 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERDTLRNTLNYLTAASAVKDAF 182 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRE++TLRNTLNYLTAASAVKD F Sbjct: 220 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKREKETLRNTLNYLTAASAVKDVF 279 >ref|NP_177679.1| ATP-dependent protease La domain-containing protein [Arabidopsis thaliana] gi|10120444|gb|AAG13069.1|AC023754_7 Unknown protein [Arabidopsis thaliana] gi|15028233|gb|AAK76613.1| putative protease [Arabidopsis thaliana] gi|21618023|gb|AAM67073.1| protease, putative [Arabidopsis thaliana] gi|23296404|gb|AAN13110.1| putative protease [Arabidopsis thaliana] gi|332197602|gb|AEE35723.1| ATP-dependent protease La domain-containing protein [Arabidopsis thaliana] Length = 278 Score = 115 bits (287), Expect = 6e-24 Identities = 57/60 (95%), Positives = 58/60 (96%) Frame = +3 Query: 3 RNLFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERDTLRNTLNYLTAASAVKDAF 182 RN FPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRER+TLRNTLNYLTAASAVKD F Sbjct: 215 RNQFPTPFSFFVGSTFEGAPREQQALLELEDTAARLKRERETLRNTLNYLTAASAVKDVF 274