BLASTX nr result
ID: Dioscorea21_contig00011210
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00011210 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_563924.1| nuclear matrix constituent protein-like protein... 61 1e-07 dbj|BAF00573.1| putative nuclear matrix constituent protein [Ara... 61 1e-07 ref|XP_002525969.1| DNA double-strand break repair rad50 ATPase,... 60 1e-07 ref|XP_004147138.1| PREDICTED: putative nuclear matrix constitue... 60 2e-07 ref|XP_002278531.2| PREDICTED: putative nuclear matrix constitue... 59 3e-07 >ref|NP_563924.1| nuclear matrix constituent protein-like protein [Arabidopsis thaliana] gi|4850405|gb|AAD31075.1|AC007357_24 Similar to gb|D64087 nuclear matrix constituent protein 1 (NMCP1) from Daucus carota [Arabidopsis thaliana] gi|332190866|gb|AEE28987.1| nuclear matrix constituent protein-like protein [Arabidopsis thaliana] Length = 1128 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/69 (42%), Positives = 45/69 (65%) Frame = -3 Query: 209 EERDQHXXXXXXXKDEIEDCGLMKKSLEKQIEDLRSEKERFESEWEVLDEKRSALNAELN 30 EER+++ K +IE + ++ L K++E+L+ EKERFE EWE+LDEK++ N E Sbjct: 514 EEREEYLRLQSELKSQIEKSRVHEEFLSKEVENLKQEKERFEKEWEILDEKQAVYNKERI 573 Query: 29 PYIDEREKF 3 +E+EKF Sbjct: 574 RISEEKEKF 582 >dbj|BAF00573.1| putative nuclear matrix constituent protein [Arabidopsis thaliana] Length = 743 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/69 (42%), Positives = 45/69 (65%) Frame = -3 Query: 209 EERDQHXXXXXXXKDEIEDCGLMKKSLEKQIEDLRSEKERFESEWEVLDEKRSALNAELN 30 EER+++ K +IE + ++ L K++E+L+ EKERFE EWE+LDEK++ N E Sbjct: 129 EEREEYLRLQSELKSQIEKSRVHEEFLSKEVENLKQEKERFEKEWEILDEKQAVYNKERI 188 Query: 29 PYIDEREKF 3 +E+EKF Sbjct: 189 RISEEKEKF 197 >ref|XP_002525969.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus communis] gi|223534701|gb|EEF36393.1| DNA double-strand break repair rad50 ATPase, putative [Ricinus communis] Length = 1163 Score = 60.5 bits (145), Expect = 1e-07 Identities = 29/69 (42%), Positives = 43/69 (62%) Frame = -3 Query: 209 EERDQHXXXXXXXKDEIEDCGLMKKSLEKQIEDLRSEKERFESEWEVLDEKRSALNAELN 30 EER ++ K+EIE C L ++ K++EDL+ +KE FE EW+ LDEKR + +L Sbjct: 499 EERVEYVRLQSELKEEIEKCRLQEQLFLKEVEDLKQQKENFEREWDDLDEKRVEIEKQLK 558 Query: 29 PYIDEREKF 3 ++REKF Sbjct: 559 SISEQREKF 567 >ref|XP_004147138.1| PREDICTED: putative nuclear matrix constituent protein 1-like protein-like [Cucumis sativus] Length = 1169 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/68 (41%), Positives = 42/68 (61%) Frame = -3 Query: 209 EERDQHXXXXXXXKDEIEDCGLMKKSLEKQIEDLRSEKERFESEWEVLDEKRSALNAELN 30 EER +H EIE L K + K+ EDL+ E+ +FE +WE LDEKR+ ++ EL+ Sbjct: 519 EERSEHVRLECQLMQEIESYRLQNKIVMKEHEDLKQERVKFERDWEALDEKRTEIHDELS 578 Query: 29 PYIDEREK 6 ++ER+K Sbjct: 579 DLVEERKK 586 >ref|XP_002278531.2| PREDICTED: putative nuclear matrix constituent protein 1-like protein-like [Vitis vinifera] Length = 1213 Score = 59.3 bits (142), Expect = 3e-07 Identities = 28/68 (41%), Positives = 41/68 (60%) Frame = -3 Query: 209 EERDQHXXXXXXXKDEIEDCGLMKKSLEKQIEDLRSEKERFESEWEVLDEKRSALNAELN 30 EER +H K EI+ C ++ L+K+ EDL+ E+ FE +WE LDEKR+ + E+ Sbjct: 521 EERSEHHRLQLELKQEIDKCRHQEEMLQKEREDLKQERIMFEKDWEALDEKRAVITKEMR 580 Query: 29 PYIDEREK 6 DE+EK Sbjct: 581 EIGDEKEK 588