BLASTX nr result
ID: Dioscorea21_contig00010484
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00010484 (231 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase [deca... 68 9e-10 ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus com... 67 2e-09 sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase [decarb... 66 3e-09 emb|CAA38252.1| P-protein subunit of glycine decarboxylase enzym... 66 3e-09 ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxyl... 65 6e-09 >sp|O49954.1|GCSP_SOLTU RecName: Full=Glycine dehydrogenase [decarboxylating], mitochondrial; AltName: Full=Glycine cleavage system P protein; AltName: Full=Glycine decarboxylase; Flags: Precursor gi|2894362|emb|CAB16918.1| P-Protein precursor [Solanum tuberosum] Length = 1035 Score = 67.8 bits (164), Expect = 9e-10 Identities = 29/32 (90%), Positives = 32/32 (100%) Frame = -3 Query: 223 KFWPTTGRVDNVYGDRNLICTLLPVSQMADEQ 128 KFWPTTGRVDNVYGDRNLICTLLPVS+MA+E+ Sbjct: 1000 KFWPTTGRVDNVYGDRNLICTLLPVSEMAEEK 1031 >ref|XP_002516446.1| glycine dehydrogenase, putative [Ricinus communis] gi|223544266|gb|EEF45787.1| glycine dehydrogenase, putative [Ricinus communis] Length = 1057 Score = 66.6 bits (161), Expect = 2e-09 Identities = 29/34 (85%), Positives = 30/34 (88%) Frame = -3 Query: 229 GFKFWPTTGRVDNVYGDRNLICTLLPVSQMADEQ 128 G KFWPTTGRVDNVYGDRNLICTLLP SQ +EQ Sbjct: 1019 GAKFWPTTGRVDNVYGDRNLICTLLPASQYVEEQ 1052 >sp|P26969.1|GCSP_PEA RecName: Full=Glycine dehydrogenase [decarboxylating], mitochondrial; AltName: Full=Glycine cleavage system P protein; AltName: Full=Glycine decarboxylase; Flags: Precursor gi|20741|emb|CAA42443.1| P protein [Pisum sativum] Length = 1057 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 229 GFKFWPTTGRVDNVYGDRNLICTLLPVSQMADEQ 128 G KFWPTTGRVDNVYGDRNL+CTLLP SQ +EQ Sbjct: 1019 GAKFWPTTGRVDNVYGDRNLVCTLLPASQAVEEQ 1052 >emb|CAA38252.1| P-protein subunit of glycine decarboxylase enzyme complex [Pisum sativum] Length = 153 Score = 66.2 bits (160), Expect = 3e-09 Identities = 28/34 (82%), Positives = 30/34 (88%) Frame = -3 Query: 229 GFKFWPTTGRVDNVYGDRNLICTLLPVSQMADEQ 128 G KFWPTTGRVDNVYGDRNL+CTLLP SQ +EQ Sbjct: 115 GAKFWPTTGRVDNVYGDRNLVCTLLPASQAVEEQ 148 >ref|XP_003550270.1| PREDICTED: glycine dehydrogenase [decarboxylating], mitochondrial-like [Glycine max] Length = 1056 Score = 65.1 bits (157), Expect = 6e-09 Identities = 28/32 (87%), Positives = 29/32 (90%) Frame = -3 Query: 223 KFWPTTGRVDNVYGDRNLICTLLPVSQMADEQ 128 KFWPTTGRVDNVYGDRNLICTLLP SQ +EQ Sbjct: 1020 KFWPTTGRVDNVYGDRNLICTLLPASQAVEEQ 1051