BLASTX nr result
ID: Dioscorea21_contig00010182
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00010182 (513 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_003413322.1| hypothetical protein LM5578_1210 [Listeria m... 55 5e-06 >ref|YP_003413322.1| hypothetical protein LM5578_1210 [Listeria monocytogenes 08-5578] gi|284994599|ref|YP_003416367.1| hypothetical protein LM5923_1163 [Listeria monocytogenes 08-5923] gi|284057019|gb|ADB67960.1| hypothetical protein LM5578_1210 [Listeria monocytogenes 08-5578] gi|284060066|gb|ADB71005.1| hypothetical protein LM5923_1163 [Listeria monocytogenes 08-5923] Length = 566 Score = 55.5 bits (132), Expect = 5e-06 Identities = 41/137 (29%), Positives = 65/137 (47%), Gaps = 6/137 (4%) Frame = -1 Query: 456 PLLIGMSPELKALYKDKLTNPFLLKRSSEFVNEQAKPSQHGTEPVDLQD----VDGL--I 295 P+ IG L Y K+T P L K +PVD D VD + + Sbjct: 367 PVTIG---SLTTTYSGKITQPLLEKPVDPVTPVDPVDPVDPVDPVDPVDPVDPVDPVDPV 423 Query: 294 DLNNVTEPVDTLNLGEYVDQINVAEPVDTMNLAGPVDQINVVEPVDLQNVSEPVNLQNVA 115 D + +PVD ++ + VD ++ +PVD ++ PVD +N V+PVD + +PV+ N Sbjct: 424 DPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVDPVNPVDPVDPVDPVDPVDPVNPV 483 Query: 114 EPVNMQIDTHDNPLENI 64 +PVN NP++ + Sbjct: 484 DPVNPVNPDPVNPMKPV 500