BLASTX nr result
ID: Dioscorea21_contig00010004
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00010004 (446 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004147963.1| PREDICTED: histone deacetylase complex subun... 58 7e-07 gb|AEO34811.1| hypothetical protein [Amblyomma maculatum] 58 7e-07 >ref|XP_004147963.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] gi|449494271|ref|XP_004159498.1| PREDICTED: histone deacetylase complex subunit SAP18-like [Cucumis sativus] Length = 166 Score = 58.2 bits (139), Expect = 7e-07 Identities = 25/37 (67%), Positives = 31/37 (83%) Frame = +1 Query: 1 RPVGMTHSHGNGRRMDDHQTLADLSFQIGDYLSVAII 111 + VGMTHS+GNGRR+DD + L +L FQIGDYL VAI+ Sbjct: 130 KQVGMTHSYGNGRRLDDSKALGELDFQIGDYLDVAIL 166 >gb|AEO34811.1| hypothetical protein [Amblyomma maculatum] Length = 153 Score = 58.2 bits (139), Expect = 7e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +1 Query: 7 VGMTHSHGNGRRMDDHQTLADLSFQIGDYLSVAII 111 VGMT+S GNGRR+DD +TL DL FQIGDYLSVAI+ Sbjct: 119 VGMTYSFGNGRRIDDGKTLKDLGFQIGDYLSVAIL 153