BLASTX nr result
ID: Dioscorea21_contig00007884
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007884 (217 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABC01890.1| malate dehydrogenase-like protein [Solanum tubero... 68 9e-10 emb|CAC12826.1| malate dehydrogenase [Nicotiana tabacum] 67 1e-09 ref|XP_002533463.1| malate dehydrogenase, putative [Ricinus comm... 66 3e-09 gb|AAL11502.1|AF367442_1 NAD-dependent malate dehydrogenase [Pru... 66 3e-09 gb|AEM97865.1| malate dehydrogenase [Corylus heterophylla] 65 4e-09 >gb|ABC01890.1| malate dehydrogenase-like protein [Solanum tuberosum] Length = 332 Score = 67.8 bits (164), Expect = 9e-10 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 217 RNGEWSIVQDLSIDEFSRKKMDATAEELSEEKALAY 110 +NGEWSIVQDL IDEFSRKK+D TAEELSEEKALAY Sbjct: 293 KNGEWSIVQDLPIDEFSRKKLDLTAEELSEEKALAY 328 >emb|CAC12826.1| malate dehydrogenase [Nicotiana tabacum] Length = 332 Score = 67.0 bits (162), Expect = 1e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = -1 Query: 217 RNGEWSIVQDLSIDEFSRKKMDATAEELSEEKALAY 110 +NGEWSIVQ L IDEFSRKK+DATAEELSEEKALAY Sbjct: 293 KNGEWSIVQGLPIDEFSRKKLDATAEELSEEKALAY 328 >ref|XP_002533463.1| malate dehydrogenase, putative [Ricinus communis] gi|223526678|gb|EEF28915.1| malate dehydrogenase, putative [Ricinus communis] Length = 332 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 217 RNGEWSIVQDLSIDEFSRKKMDATAEELSEEKALAY 110 +NGEW IVQ LSIDEFSRKK+D+TAEELSEEKALAY Sbjct: 293 QNGEWKIVQGLSIDEFSRKKLDSTAEELSEEKALAY 328 >gb|AAL11502.1|AF367442_1 NAD-dependent malate dehydrogenase [Prunus persica] Length = 332 Score = 65.9 bits (159), Expect = 3e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = -1 Query: 217 RNGEWSIVQDLSIDEFSRKKMDATAEELSEEKALAY 110 +NGEW IVQ LSIDEFSRKK+DATA+ELSEEKALAY Sbjct: 293 QNGEWKIVQGLSIDEFSRKKLDATADELSEEKALAY 328 >gb|AEM97865.1| malate dehydrogenase [Corylus heterophylla] Length = 332 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/36 (86%), Positives = 33/36 (91%) Frame = -1 Query: 217 RNGEWSIVQDLSIDEFSRKKMDATAEELSEEKALAY 110 RNGEW IVQ LSIDEFSRKK+D TAEEL+EEKALAY Sbjct: 293 RNGEWKIVQGLSIDEFSRKKLDLTAEELTEEKALAY 328