BLASTX nr result
ID: Dioscorea21_contig00007795
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007795 (300 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002466284.1| hypothetical protein SORBIDRAFT_01g005010 [S... 56 3e-06 >ref|XP_002466284.1| hypothetical protein SORBIDRAFT_01g005010 [Sorghum bicolor] gi|241920138|gb|EER93282.1| hypothetical protein SORBIDRAFT_01g005010 [Sorghum bicolor] Length = 281 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/32 (81%), Positives = 30/32 (93%) Frame = -1 Query: 300 KNKLPPNFAKLLLVRLRKLTASGKLTKVKNSY 205 K+KLPPNF KLLLV+L+KL A+GKLTKVKNSY Sbjct: 84 KDKLPPNFRKLLLVQLKKLVAAGKLTKVKNSY 115