BLASTX nr result
ID: Dioscorea21_contig00007733
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00007733 (435 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464034.1| hypothetical protein SORBIDRAFT_01g010950 [S... 55 5e-06 >ref|XP_002464034.1| hypothetical protein SORBIDRAFT_01g010950 [Sorghum bicolor] gi|241917888|gb|EER91032.1| hypothetical protein SORBIDRAFT_01g010950 [Sorghum bicolor] Length = 168 Score = 55.5 bits (132), Expect = 5e-06 Identities = 26/35 (74%), Positives = 28/35 (80%) Frame = +3 Query: 291 EGENRAKRRRTGDGLVIYSAEELGFGNPDAGGTPL 395 E E + RRRT DGLVIYSA+ELGFG DAGGTPL Sbjct: 125 EFEEKRPRRRTADGLVIYSADELGFGKADAGGTPL 159