BLASTX nr result
ID: Dioscorea21_contig00005773
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00005773 (211 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFK40263.1| unknown [Medicago truncatula] 80 2e-13 ref|XP_003591771.1| Hippocampus abundant transcript-like protein... 80 2e-13 ref|XP_003535506.1| PREDICTED: hippocampus abundant transcript-l... 79 5e-13 ref|XP_003591772.1| Hippocampus abundant transcript-like protein... 76 2e-12 gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sa... 76 3e-12 >gb|AFK40263.1| unknown [Medicago truncatula] Length = 442 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 209 FFYKLGITGISSVLLYYLKTIFGFNKNQFSEILLVVGIGSTFSQL 75 FFYKLG+TGI SVLLYYLK +FGFNKNQFSE+L++VGIGS FSQ+ Sbjct: 246 FFYKLGMTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQI 290 >ref|XP_003591771.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480819|gb|AES62022.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Length = 442 Score = 79.7 bits (195), Expect = 2e-13 Identities = 36/45 (80%), Positives = 42/45 (93%) Frame = -3 Query: 209 FFYKLGITGISSVLLYYLKTIFGFNKNQFSEILLVVGIGSTFSQL 75 FFYKLG+TGI SVLLYYLK +FGFNKNQFSE+L++VGIGS FSQ+ Sbjct: 246 FFYKLGMTGIHSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQI 290 >ref|XP_003535506.1| PREDICTED: hippocampus abundant transcript-like protein 1-like [Glycine max] Length = 442 Score = 78.6 bits (192), Expect = 5e-13 Identities = 35/45 (77%), Positives = 43/45 (95%) Frame = -3 Query: 209 FFYKLGITGISSVLLYYLKTIFGFNKNQFSEILLVVGIGSTFSQL 75 FFY+LG++GISSVLLYYLK +FGFNKNQFSE+L++VGIGS FSQ+ Sbjct: 246 FFYELGMSGISSVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQM 290 >ref|XP_003591772.1| Hippocampus abundant transcript-like protein [Medicago truncatula] gi|355480820|gb|AES62023.1| Hippocampus abundant transcript-like protein [Medicago truncatula] Length = 441 Score = 76.3 bits (186), Expect = 2e-12 Identities = 33/45 (73%), Positives = 43/45 (95%) Frame = -3 Query: 209 FFYKLGITGISSVLLYYLKTIFGFNKNQFSEILLVVGIGSTFSQL 75 FFY+LG++GI++VLLYYLK +FGFNKNQFSE+L++VGIGS FSQ+ Sbjct: 246 FFYELGMSGITTVLLYYLKAVFGFNKNQFSELLMMVGIGSIFSQI 290 >gb|AAX94836.1| Major Facilitator Superfamily, putative [Oryza sativa Japonica Group] gi|77548658|gb|ABA91455.1| Major Facilitator Superfamily protein, expressed [Oryza sativa Japonica Group] Length = 1143 Score = 75.9 bits (185), Expect = 3e-12 Identities = 34/45 (75%), Positives = 42/45 (93%) Frame = -3 Query: 209 FFYKLGITGISSVLLYYLKTIFGFNKNQFSEILLVVGIGSTFSQL 75 FFY+LG+ GIS VL+YYLK++FGF+KNQFSEIL+VVGIGS FSQ+ Sbjct: 942 FFYELGMIGISDVLMYYLKSVFGFDKNQFSEILMVVGIGSIFSQI 986