BLASTX nr result
ID: Dioscorea21_contig00004334
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00004334 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vi... 75 6e-12 gb|AEZ52388.1| light-regulated protein precursor [Wolffia austra... 75 7e-12 gb|AEY84986.1| light-regulated protein [Wolffia australiana] 73 2e-11 gb|ABV89628.1| light regulated protein-like protein [Brassica rapa] 72 5e-11 emb|CAA46272.1| GA [Pisum sativum] 72 6e-11 >ref|XP_002269300.1| PREDICTED: light-regulated protein [Vitis vinifera] gi|296088179|emb|CBI35671.3| unnamed protein product [Vitis vinifera] Length = 139 Score = 75.1 bits (183), Expect = 6e-12 Identities = 31/45 (68%), Positives = 37/45 (82%) Frame = -1 Query: 293 NAKAKVASTEIDRDYLEYNEPRTVFPDEACDDLGGEFCDPEYQRG 159 N A+ A+ +DR+YLEYN P+TVFP EACDDLGGEFC+PEYQ G Sbjct: 90 NPPARSATEGVDREYLEYNSPKTVFPGEACDDLGGEFCEPEYQEG 134 >gb|AEZ52388.1| light-regulated protein precursor [Wolffia australiana] gi|374433998|gb|AEZ52391.1| light-regulated protein precursor [Wolffia australiana] Length = 135 Score = 74.7 bits (182), Expect = 7e-12 Identities = 33/49 (67%), Positives = 41/49 (83%), Gaps = 3/49 (6%) Frame = -1 Query: 299 PSNAKA---KVASTEIDRDYLEYNEPRTVFPDEACDDLGGEFCDPEYQR 162 P+N A K +S +IDR+YL+Y+EPRTVFPDEACDDLGG+FC PEYQ+ Sbjct: 86 PANNSANANKPSSEQIDREYLDYSEPRTVFPDEACDDLGGDFCKPEYQK 134 >gb|AEY84986.1| light-regulated protein [Wolffia australiana] Length = 135 Score = 73.2 bits (178), Expect = 2e-11 Identities = 32/49 (65%), Positives = 40/49 (81%), Gaps = 3/49 (6%) Frame = -1 Query: 299 PSNAKA---KVASTEIDRDYLEYNEPRTVFPDEACDDLGGEFCDPEYQR 162 P+N A K +S +IDR+YL+Y+EPRTVFPDE CDDLGG+FC PEYQ+ Sbjct: 86 PANNSANANKPSSEQIDREYLDYSEPRTVFPDEVCDDLGGDFCKPEYQK 134 >gb|ABV89628.1| light regulated protein-like protein [Brassica rapa] Length = 138 Score = 72.0 bits (175), Expect = 5e-11 Identities = 29/39 (74%), Positives = 35/39 (89%) Frame = -1 Query: 278 VASTEIDRDYLEYNEPRTVFPDEACDDLGGEFCDPEYQR 162 VAS +DR+YLEYN P+TVFP EACDDLGGEFC+P+YQ+ Sbjct: 97 VASEPVDREYLEYNNPKTVFPAEACDDLGGEFCEPDYQK 135 >emb|CAA46272.1| GA [Pisum sativum] Length = 142 Score = 71.6 bits (174), Expect = 6e-11 Identities = 30/46 (65%), Positives = 37/46 (80%) Frame = -1 Query: 296 SNAKAKVASTEIDRDYLEYNEPRTVFPDEACDDLGGEFCDPEYQRG 159 ++A AS IDRDYLEYN+P+TVF EACDDLGG FC+P+YQ+G Sbjct: 95 NDAPKTAASENIDRDYLEYNDPKTVFQAEACDDLGGTFCEPDYQKG 140