BLASTX nr result
ID: Dioscorea21_contig00003933
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00003933 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFD62419.1| reduced height-2 [Eragrostis tef] gi|380504070|gb... 112 3e-23 gb|AFD62413.1| reduced height-2 [Eragrostis tef] gi|380504058|gb... 112 3e-23 gb|AFD62396.1| reduced height-2 [Eragrostis tef] gi|380504024|gb... 112 3e-23 gb|AFD62391.1| reduced height-2 [Eragrostis tef] gi|380504014|gb... 112 3e-23 gb|AFD62385.1| reduced height-1 [Eragrostis tef] gi|380504002|gb... 112 3e-23 >gb|AFD62419.1| reduced height-2 [Eragrostis tef] gi|380504070|gb|AFD62420.1| reduced height-2 [Eragrostis tef] gi|380504072|gb|AFD62421.1| reduced height-2 [Eragrostis tef] Length = 617 Score = 112 bits (280), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 SRMVRAGFEPAHLGSNAFKQASILLEFFAGGDGYRVEERDGCLTLGWHSRPLIATSAWRL 182 +R+ RAGFEP HLGSNA+KQAS LL FAGGDGYRVEE+DGCLTLGWH+RPLIATSAWRL Sbjct: 555 NRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRL 614 Query: 183 A 185 A Sbjct: 615 A 615 >gb|AFD62413.1| reduced height-2 [Eragrostis tef] gi|380504058|gb|AFD62414.1| reduced height-2 [Eragrostis tef] gi|380504060|gb|AFD62415.1| reduced height-2 [Eragrostis tef] gi|380504062|gb|AFD62416.1| reduced height-2 [Eragrostis tef] gi|380504064|gb|AFD62417.1| reduced height-2 [Eragrostis tef] gi|380504066|gb|AFD62418.1| reduced height-2 [Eragrostis tef] Length = 617 Score = 112 bits (280), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 SRMVRAGFEPAHLGSNAFKQASILLEFFAGGDGYRVEERDGCLTLGWHSRPLIATSAWRL 182 +R+ RAGFEP HLGSNA+KQAS LL FAGGDGYRVEE+DGCLTLGWH+RPLIATSAWRL Sbjct: 555 NRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRL 614 Query: 183 A 185 A Sbjct: 615 A 615 >gb|AFD62396.1| reduced height-2 [Eragrostis tef] gi|380504024|gb|AFD62397.1| reduced height-2 [Eragrostis tef] gi|380504026|gb|AFD62398.1| reduced height-2 [Eragrostis tef] gi|380504028|gb|AFD62399.1| reduced height-2 [Eragrostis tef] gi|380504030|gb|AFD62400.1| reduced height-2 [Eragrostis tef] gi|380504032|gb|AFD62401.1| reduced height-2 [Eragrostis tef] gi|380504034|gb|AFD62402.1| reduced height-2 [Eragrostis tef] gi|380504036|gb|AFD62403.1| reduced height-2 [Eragrostis tef] gi|380504038|gb|AFD62404.1| reduced height-2 [Eragrostis tef] gi|380504040|gb|AFD62405.1| reduced height-2 [Eragrostis tef] gi|380504042|gb|AFD62406.1| reduced height-2 [Eragrostis tef] gi|380504044|gb|AFD62407.1| reduced height-2 [Eragrostis tef] gi|380504046|gb|AFD62408.1| reduced height-2 [Eragrostis tef] gi|380504048|gb|AFD62409.1| reduced height-2 [Eragrostis tef] gi|380504050|gb|AFD62410.1| reduced height-2 [Eragrostis tef] gi|380504052|gb|AFD62411.1| reduced height-2 [Eragrostis tef] gi|380504054|gb|AFD62412.1| reduced height-2 [Eragrostis tef] Length = 617 Score = 112 bits (280), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 SRMVRAGFEPAHLGSNAFKQASILLEFFAGGDGYRVEERDGCLTLGWHSRPLIATSAWRL 182 +R+ RAGFEP HLGSNA+KQAS LL FAGGDGYRVEE+DGCLTLGWH+RPLIATSAWRL Sbjct: 555 NRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRL 614 Query: 183 A 185 A Sbjct: 615 A 615 >gb|AFD62391.1| reduced height-2 [Eragrostis tef] gi|380504014|gb|AFD62392.1| reduced height-2 [Eragrostis tef] gi|380504016|gb|AFD62393.1| reduced height-2 [Eragrostis tef] gi|380504018|gb|AFD62394.1| reduced height-2 [Eragrostis tef] gi|380504020|gb|AFD62395.1| reduced height-2 [Eragrostis tef] Length = 617 Score = 112 bits (280), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 SRMVRAGFEPAHLGSNAFKQASILLEFFAGGDGYRVEERDGCLTLGWHSRPLIATSAWRL 182 +R+ RAGFEP HLGSNA+KQAS LL FAGGDGYRVEE+DGCLTLGWH+RPLIATSAWRL Sbjct: 555 NRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRL 614 Query: 183 A 185 A Sbjct: 615 A 615 >gb|AFD62385.1| reduced height-1 [Eragrostis tef] gi|380504002|gb|AFD62386.1| reduced height-1 [Eragrostis tef] gi|380504004|gb|AFD62387.1| reduced height-1 [Eragrostis tef] gi|380504006|gb|AFD62388.1| reduced height-1 [Eragrostis tef] Length = 618 Score = 112 bits (280), Expect = 3e-23 Identities = 51/61 (83%), Positives = 56/61 (91%) Frame = +3 Query: 3 SRMVRAGFEPAHLGSNAFKQASILLEFFAGGDGYRVEERDGCLTLGWHSRPLIATSAWRL 182 +R+ RAGFEP HLGSNA+KQAS LL FAGGDGYRVEE+DGCLTLGWH+RPLIATSAWRL Sbjct: 556 NRLGRAGFEPVHLGSNAYKQASTLLALFAGGDGYRVEEKDGCLTLGWHTRPLIATSAWRL 615 Query: 183 A 185 A Sbjct: 616 A 616