BLASTX nr result
ID: Dioscorea21_contig00002901
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00002901 (345 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002301723.1| predicted protein [Populus trichocarpa] gi|2... 59 5e-07 ref|XP_003598669.1| hypothetical protein MTR_3g019060 [Medicago ... 59 5e-07 >ref|XP_002301723.1| predicted protein [Populus trichocarpa] gi|222843449|gb|EEE80996.1| predicted protein [Populus trichocarpa] Length = 291 Score = 58.5 bits (140), Expect = 5e-07 Identities = 24/48 (50%), Positives = 36/48 (75%) Frame = +1 Query: 1 CMDVLDSMEAVPNDLYIKVLKKFTDPDWRRMFIKMPHFRRKYWVENLD 144 CMD L++++ V + YIK L+KF DPDWR MF+KM R+K W+++L+ Sbjct: 244 CMDELENLDDVSDTSYIKALEKFKDPDWRIMFVKMSLVRKKSWLKSLE 291 >ref|XP_003598669.1| hypothetical protein MTR_3g019060 [Medicago truncatula] gi|355487717|gb|AES68920.1| hypothetical protein MTR_3g019060 [Medicago truncatula] Length = 133 Score = 58.5 bits (140), Expect = 5e-07 Identities = 23/47 (48%), Positives = 32/47 (68%) Frame = +1 Query: 1 CMDVLDSMEAVPNDLYIKVLKKFTDPDWRRMFIKMPHFRRKYWVENL 141 C+ LD +E + +D+Y+K +KF DPDWR MF+ MP RRK W+ L Sbjct: 87 CVTALDKIEDITDDIYMKACEKFMDPDWREMFLAMPSHRRKGWLVRL 133