BLASTX nr result
ID: Dioscorea21_contig00002618
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00002618 (310 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003577810.1| PREDICTED: syntaxin-61-like [Brachypodium di... 110 9e-23 ref|XP_002449051.1| hypothetical protein SORBIDRAFT_05g004120 [S... 109 3e-22 gb|AFW89302.1| hypothetical protein ZEAMMB73_776234 [Zea mays] 108 6e-22 dbj|BAJ86239.1| predicted protein [Hordeum vulgare subsp. vulgar... 107 1e-21 ref|XP_002459155.1| hypothetical protein SORBIDRAFT_03g046820 [S... 107 1e-21 >ref|XP_003577810.1| PREDICTED: syntaxin-61-like [Brachypodium distachyon] Length = 235 Score = 110 bits (276), Expect = 9e-23 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = +3 Query: 123 MTPAQDPFYIVKEEIQESIDKLQATFRQWEETPSNTGEWVHLSKELVASCESIEWQVDEL 302 MTPAQDPFYIVK+EIQ+SIDK+Q TF QW++TP NTGE+VHL+KELV SCES++WQVDEL Sbjct: 1 MTPAQDPFYIVKDEIQDSIDKVQDTFHQWKQTPENTGEYVHLTKELVTSCESVQWQVDEL 60 Query: 303 DK 308 +K Sbjct: 61 EK 62 >ref|XP_002449051.1| hypothetical protein SORBIDRAFT_05g004120 [Sorghum bicolor] gi|241934894|gb|EES08039.1| hypothetical protein SORBIDRAFT_05g004120 [Sorghum bicolor] Length = 235 Score = 109 bits (272), Expect = 3e-22 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = +3 Query: 123 MTPAQDPFYIVKEEIQESIDKLQATFRQWEETPSNTGEWVHLSKELVASCESIEWQVDEL 302 MTPAQDPFYIVK+EIQ+SIDK+Q TF QW++TP NTGE+VHL+KEL+ SCESI+WQVDEL Sbjct: 1 MTPAQDPFYIVKDEIQDSIDKVQDTFLQWKQTPENTGEYVHLTKELLTSCESIQWQVDEL 60 Query: 303 DK 308 +K Sbjct: 61 EK 62 >gb|AFW89302.1| hypothetical protein ZEAMMB73_776234 [Zea mays] Length = 232 Score = 108 bits (269), Expect = 6e-22 Identities = 49/62 (79%), Positives = 58/62 (93%) Frame = +3 Query: 123 MTPAQDPFYIVKEEIQESIDKLQATFRQWEETPSNTGEWVHLSKELVASCESIEWQVDEL 302 M+ AQDPFYIV+EEIQESIDKLQ+TF +WE+T SNTGE+VHL+KEL+ SCESIEWQVDEL Sbjct: 1 MSSAQDPFYIVREEIQESIDKLQSTFHRWEQTASNTGEYVHLTKELLISCESIEWQVDEL 60 Query: 303 DK 308 +K Sbjct: 61 EK 62 >dbj|BAJ86239.1| predicted protein [Hordeum vulgare subsp. vulgare] gi|326512364|dbj|BAJ99537.1| predicted protein [Hordeum vulgare subsp. vulgare] Length = 235 Score = 107 bits (267), Expect = 1e-21 Identities = 45/62 (72%), Positives = 58/62 (93%) Frame = +3 Query: 123 MTPAQDPFYIVKEEIQESIDKLQATFRQWEETPSNTGEWVHLSKELVASCESIEWQVDEL 302 MTPAQDPFYIVK+EIQ+SIDK+Q TF QW++TP NTGE+VHL++EL+ +CES++WQVDEL Sbjct: 1 MTPAQDPFYIVKDEIQDSIDKVQDTFNQWKQTPENTGEYVHLTRELLTTCESVQWQVDEL 60 Query: 303 DK 308 +K Sbjct: 61 EK 62 >ref|XP_002459155.1| hypothetical protein SORBIDRAFT_03g046820 [Sorghum bicolor] gi|241931130|gb|EES04275.1| hypothetical protein SORBIDRAFT_03g046820 [Sorghum bicolor] Length = 232 Score = 107 bits (267), Expect = 1e-21 Identities = 48/62 (77%), Positives = 58/62 (93%) Frame = +3 Query: 123 MTPAQDPFYIVKEEIQESIDKLQATFRQWEETPSNTGEWVHLSKELVASCESIEWQVDEL 302 M+ AQDPFYIV+EEIQ+SIDKLQ+TF +WE+T SNTGE+VHL+KEL+ SCESIEWQVDEL Sbjct: 1 MSSAQDPFYIVREEIQDSIDKLQSTFHRWEQTASNTGEYVHLTKELLTSCESIEWQVDEL 60 Query: 303 DK 308 +K Sbjct: 61 EK 62