BLASTX nr result
ID: Dioscorea21_contig00002508
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00002508 (299 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ADW83715.1| adenine phosphoribosyltransferase [Musa acuminata... 59 3e-07 ref|NP_001059653.1| Os07g0484800 [Oryza sativa Japonica Group] g... 59 5e-07 ref|NP_192981.1| adenine phosphoribosyl transferase 4 [Arabidops... 58 9e-07 ref|XP_002329870.1| predicted protein [Populus trichocarpa] gi|2... 57 1e-06 ref|XP_003611278.1| Adenine phosphoribosyltransferase-like prote... 57 2e-06 >gb|ADW83715.1| adenine phosphoribosyltransferase [Musa acuminata AAA Group] Length = 184 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/31 (87%), Positives = 29/31 (93%) Frame = +3 Query: 3 VVECACVIELPELKGRERLRDKPLYILVESR 95 VVECACVIELPELKGRERL KPLY+L+ESR Sbjct: 154 VVECACVIELPELKGRERLNGKPLYVLMESR 184 >ref|NP_001059653.1| Os07g0484800 [Oryza sativa Japonica Group] gi|33354190|dbj|BAC81171.1| putative adenine phosphoribosyl transferase [Oryza sativa Japonica Group] gi|113611189|dbj|BAF21567.1| Os07g0484800 [Oryza sativa Japonica Group] gi|215766188|dbj|BAG98416.1| unnamed protein product [Oryza sativa Japonica Group] Length = 187 Score = 58.5 bits (140), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = +3 Query: 3 VVECACVIELPELKGRERLRDKPLYILVES 92 VVECACVIELPELKGRERL KPLY+LVES Sbjct: 156 VVECACVIELPELKGRERLNGKPLYVLVES 185 >ref|NP_192981.1| adenine phosphoribosyl transferase 4 [Arabidopsis thaliana] gi|4725943|emb|CAB41714.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|7267946|emb|CAB78287.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|22136608|gb|AAM91623.1| putative adenine phosphoribosyltransferase [Arabidopsis thaliana] gi|332657733|gb|AEE83133.1| adenine phosphoribosyl transferase 4 [Arabidopsis thaliana] Length = 182 Score = 57.8 bits (138), Expect = 9e-07 Identities = 26/31 (83%), Positives = 28/31 (90%) Frame = +3 Query: 3 VVECACVIELPELKGRERLRDKPLYILVESR 95 V+ECACVIELPELKGRERL KPLY+LVE R Sbjct: 152 VIECACVIELPELKGRERLEGKPLYVLVEYR 182 >ref|XP_002329870.1| predicted protein [Populus trichocarpa] gi|222871107|gb|EEF08238.1| predicted protein [Populus trichocarpa] Length = 182 Score = 57.4 bits (137), Expect = 1e-06 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 VVECACVIELPELKGRERLRDKPLYILVES 92 VVECACVIELP+LKGRERL KPLY+LVES Sbjct: 152 VVECACVIELPDLKGRERLNGKPLYVLVES 181 >ref|XP_003611278.1| Adenine phosphoribosyltransferase-like protein [Medicago truncatula] gi|355512613|gb|AES94236.1| Adenine phosphoribosyltransferase-like protein [Medicago truncatula] gi|388491904|gb|AFK34018.1| unknown [Medicago truncatula] Length = 186 Score = 57.0 bits (136), Expect = 2e-06 Identities = 26/29 (89%), Positives = 27/29 (93%) Frame = +3 Query: 3 VVECACVIELPELKGRERLRDKPLYILVE 89 VVECACVIELPELKGRERL KPLY+LVE Sbjct: 154 VVECACVIELPELKGRERLNGKPLYVLVE 182