BLASTX nr result
ID: Dioscorea21_contig00001584
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00001584 (339 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160023.1| PREDICTED: uncharacterized LOC101217702 [Cuc... 55 8e-06 >ref|XP_004160023.1| PREDICTED: uncharacterized LOC101217702 [Cucumis sativus] Length = 853 Score = 54.7 bits (130), Expect = 8e-06 Identities = 24/32 (75%), Positives = 25/32 (78%) Frame = -3 Query: 337 CSDQTLFSSEEEGNGQCTGYGEITPSWLGRFK 242 CSDQTLFSSEEEG GQCTG GEI SW R + Sbjct: 805 CSDQTLFSSEEEGEGQCTGSGEIKLSWFNRLR 836