BLASTX nr result
ID: Dioscorea21_contig00001420
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00001420 (249 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003546419.1| PREDICTED: putative glucose-6-phosphate 1-ep... 66 3e-09 ref|XP_003533724.1| PREDICTED: putative glucose-6-phosphate 1-ep... 66 3e-09 ref|XP_002324462.1| predicted protein [Populus trichocarpa] gi|2... 66 3e-09 ref|XP_003594970.1| hypothetical protein MTR_2g036810 [Medicago ... 66 3e-09 ref|XP_002268176.1| PREDICTED: putative glucose-6-phosphate 1-ep... 65 4e-09 >ref|XP_003546419.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like [Glycine max] Length = 330 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 34 SEVRIEGLETLDYLDNLQGKKRFTE*GDALTFESEV 141 SEVR+EGLETLDYLDNLQ K+RFTE GDALTFESEV Sbjct: 192 SEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEV 227 >ref|XP_003533724.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 1 [Glycine max] gi|356530310|ref|XP_003533725.1| PREDICTED: putative glucose-6-phosphate 1-epimerase-like isoform 2 [Glycine max] Length = 321 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 34 SEVRIEGLETLDYLDNLQGKKRFTE*GDALTFESEV 141 SEVR+EGLETLDYLDNLQ K+RFTE GDALTFESEV Sbjct: 183 SEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEV 218 >ref|XP_002324462.1| predicted protein [Populus trichocarpa] gi|222865896|gb|EEF03027.1| predicted protein [Populus trichocarpa] Length = 315 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 34 SEVRIEGLETLDYLDNLQGKKRFTE*GDALTFESEV 141 SEVR+EGLETLDYLDNLQ K+RFTE GDALTFESEV Sbjct: 177 SEVRVEGLETLDYLDNLQNKQRFTEQGDALTFESEV 212 >ref|XP_003594970.1| hypothetical protein MTR_2g036810 [Medicago truncatula] gi|355484018|gb|AES65221.1| hypothetical protein MTR_2g036810 [Medicago truncatula] Length = 318 Score = 66.2 bits (160), Expect = 3e-09 Identities = 32/36 (88%), Positives = 34/36 (94%) Frame = +1 Query: 34 SEVRIEGLETLDYLDNLQGKKRFTE*GDALTFESEV 141 SEVR+EGLETLDYLDNLQ K+RFTE GDALTFESEV Sbjct: 180 SEVRVEGLETLDYLDNLQNKERFTEQGDALTFESEV 215 >ref|XP_002268176.1| PREDICTED: putative glucose-6-phosphate 1-epimerase [Vitis vinifera] gi|297735418|emb|CBI17858.3| unnamed protein product [Vitis vinifera] Length = 314 Score = 65.5 bits (158), Expect = 4e-09 Identities = 31/36 (86%), Positives = 34/36 (94%) Frame = +1 Query: 34 SEVRIEGLETLDYLDNLQGKKRFTE*GDALTFESEV 141 SEVR+EGLETLDYLDNLQ K+RFTE GDA+TFESEV Sbjct: 176 SEVRVEGLETLDYLDNLQNKERFTEQGDAITFESEV 211