BLASTX nr result
ID: Dioscorea21_contig00001350
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00001350 (695 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595394.1| hypothetical protein MTR_2g044940 [Medicago ... 60 5e-07 ref|XP_002519346.1| conserved hypothetical protein [Ricinus comm... 59 1e-06 ref|XP_003542398.1| PREDICTED: uncharacterized protein LOC100305... 57 3e-06 >ref|XP_003595394.1| hypothetical protein MTR_2g044940 [Medicago truncatula] gi|124360325|gb|ABN08338.1| hypothetical protein MtrDRAFT_AC155891g7v1 [Medicago truncatula] gi|355484442|gb|AES65645.1| hypothetical protein MTR_2g044940 [Medicago truncatula] Length = 74 Score = 59.7 bits (143), Expect = 5e-07 Identities = 27/35 (77%), Positives = 30/35 (85%) Frame = -3 Query: 615 AGHDHQGMKLHCEVMACAYEDVHVMWSILDKSKST 511 A +++GM LH EVMAC YEDVHVMWSILDKSKST Sbjct: 33 AEQENRGMDLHGEVMACGYEDVHVMWSILDKSKST 67 >ref|XP_002519346.1| conserved hypothetical protein [Ricinus communis] gi|223541661|gb|EEF43210.1| conserved hypothetical protein [Ricinus communis] Length = 75 Score = 58.5 bits (140), Expect = 1e-06 Identities = 26/35 (74%), Positives = 30/35 (85%) Frame = -3 Query: 612 GHDHQGMKLHCEVMACAYEDVHVMWSILDKSKSTN 508 G++++ M LH EVMAC YEDV VMWSILDKSKSTN Sbjct: 35 GNENRAMDLHGEVMACGYEDVQVMWSILDKSKSTN 69 >ref|XP_003542398.1| PREDICTED: uncharacterized protein LOC100305862 [Glycine max] gi|255626813|gb|ACU13751.1| unknown [Glycine max] Length = 76 Score = 57.0 bits (136), Expect = 3e-06 Identities = 27/37 (72%), Positives = 28/37 (75%) Frame = -3 Query: 618 QAGHDHQGMKLHCEVMACAYEDVHVMWSILDKSKSTN 508 Q + Q M LH EVMAC YEDV VMWSILDKSKSTN Sbjct: 33 QTEQERQVMDLHGEVMACGYEDVQVMWSILDKSKSTN 69