BLASTX nr result
ID: Dioscorea21_contig00001229
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00001229 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002285601.1| PREDICTED: uncharacterized protein LOC100255... 57 2e-06 >ref|XP_002285601.1| PREDICTED: uncharacterized protein LOC100255721 [Vitis vinifera] Length = 462 Score = 56.6 bits (135), Expect = 2e-06 Identities = 33/68 (48%), Positives = 41/68 (60%), Gaps = 3/68 (4%) Frame = +3 Query: 60 PDYLFGLEKGLAPAPAVKTQDPAPVFVTPEPLPVEAPLSRSDLPKDDRPIA---VESGLN 230 PD+LFGL+KGLAP P VK QDP P P+ LP + + RSD +DR + V S + Sbjct: 184 PDFLFGLDKGLAPPPPVKLQDPTPPPTVPDVLPKDYSV-RSDPGSEDRHVVGDPVVSPAD 242 Query: 231 IQHQIQAL 254 Q QIQ L Sbjct: 243 YQRQIQEL 250