BLASTX nr result
ID: Dioscorea21_contig00001013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00001013 (402 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002330528.1| predicted protein [Populus trichocarpa] gi|2... 79 3e-13 ref|XP_002888883.1| hypothetical protein ARALYDRAFT_476389 [Arab... 76 3e-12 ref|NP_177399.1| phenylalanyl-tRNA synthetase beta chain [Arabid... 75 6e-12 ref|XP_002523199.1| phenylalanyl-tRNA synthetase beta chain, put... 75 6e-12 ref|XP_002269751.1| PREDICTED: probable phenylalanyl-tRNA synthe... 75 6e-12 >ref|XP_002330528.1| predicted protein [Populus trichocarpa] gi|222872462|gb|EEF09593.1| predicted protein [Populus trichocarpa] Length = 595 Score = 79.3 bits (194), Expect = 3e-13 Identities = 37/57 (64%), Positives = 42/57 (73%) Frame = +3 Query: 6 HYYEPSNLAEFFPNRQCSISFKGKKIGNFGIVHPEVLSEFKIQDPCSFLEIDIQSLL 176 +Y E SN EF P RQ SI +KGK GNFGIVHP+VL+ F I DPCSFLEIDI+ L Sbjct: 539 YYIERSNEPEFLPGRQASIIYKGKHFGNFGIVHPQVLNNFVITDPCSFLEIDIEHFL 595 >ref|XP_002888883.1| hypothetical protein ARALYDRAFT_476389 [Arabidopsis lyrata subsp. lyrata] gi|297334724|gb|EFH65142.1| hypothetical protein ARALYDRAFT_476389 [Arabidopsis lyrata subsp. lyrata] Length = 591 Score = 76.3 bits (186), Expect = 3e-12 Identities = 35/57 (61%), Positives = 44/57 (77%) Frame = +3 Query: 6 HYYEPSNLAEFFPNRQCSISFKGKKIGNFGIVHPEVLSEFKIQDPCSFLEIDIQSLL 176 +Y + S EF P RQ SI +GK+IGNFGIVHP+VL+ F I DPCSF+EIDI++LL Sbjct: 535 YYIKLSQEPEFLPGRQASIVVRGKQIGNFGIVHPQVLNNFDIPDPCSFVEIDIEALL 591 >ref|NP_177399.1| phenylalanyl-tRNA synthetase beta chain [Arabidopsis thaliana] gi|12644590|sp|Q9SGE9.1|SYFB_ARATH RecName: Full=Probable phenylalanine--tRNA ligase beta subunit; AltName: Full=Phenylalanyl-tRNA synthetase beta subunit; Short=PheRS gi|12323785|gb|AAG51865.1|AC010926_28 putative phenylalanyl-tRNA synthetase beta-subunit; PheHB; 86609-90570 [Arabidopsis thaliana] gi|17065262|gb|AAL32785.1| putative phenylalanyl-tRNA synthetase beta-subunit; PheHB [Arabidopsis thaliana] gi|22136234|gb|AAM91195.1| putative phenylalanyl-tRNA synthetase beta-subunit; PheHB [Arabidopsis thaliana] gi|332197217|gb|AEE35338.1| phenylalanyl-tRNA synthetase beta chain [Arabidopsis thaliana] Length = 598 Score = 75.1 bits (183), Expect = 6e-12 Identities = 34/57 (59%), Positives = 43/57 (75%) Frame = +3 Query: 6 HYYEPSNLAEFFPNRQCSISFKGKKIGNFGIVHPEVLSEFKIQDPCSFLEIDIQSLL 176 +Y + S EF P RQ SI +GK IGNFGIVHPEVL+ F I DPCS+LE+DI+++L Sbjct: 542 YYVKLSQEPEFLPGRQASIIVRGKHIGNFGIVHPEVLNNFDIPDPCSYLELDIEAIL 598 >ref|XP_002523199.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] gi|223537606|gb|EEF39230.1| phenylalanyl-tRNA synthetase beta chain, putative [Ricinus communis] Length = 593 Score = 75.1 bits (183), Expect = 6e-12 Identities = 35/57 (61%), Positives = 42/57 (73%) Frame = +3 Query: 6 HYYEPSNLAEFFPNRQCSISFKGKKIGNFGIVHPEVLSEFKIQDPCSFLEIDIQSLL 176 +Y + + EF P RQ SI +KGK IG FGIVHPEVL+ F I DPCSFLE+DI+ LL Sbjct: 537 YYIQCCDAPEFLPGRQASIIYKGKHIGIFGIVHPEVLNNFDIPDPCSFLELDIECLL 593 >ref|XP_002269751.1| PREDICTED: probable phenylalanyl-tRNA synthetase beta chain [Vitis vinifera] gi|297734128|emb|CBI15375.3| unnamed protein product [Vitis vinifera] Length = 592 Score = 75.1 bits (183), Expect = 6e-12 Identities = 33/57 (57%), Positives = 43/57 (75%) Frame = +3 Query: 6 HYYEPSNLAEFFPNRQCSISFKGKKIGNFGIVHPEVLSEFKIQDPCSFLEIDIQSLL 176 +Y + SN EF P RQ SI ++GK IG FGIVHPE+L+ F I DPCSFLE++++S L Sbjct: 536 YYIKLSNEPEFLPGRQASIIYRGKHIGTFGIVHPEILNNFDISDPCSFLELNMESFL 592