BLASTX nr result
ID: Dioscorea21_contig00000608
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Dioscorea21_contig00000608 (506 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAP41847.1| senescence-associated cysteine protease [Anthuriu... 55 6e-06 >gb|AAP41847.1| senescence-associated cysteine protease [Anthurium andraeanum] Length = 460 Score = 55.1 bits (131), Expect = 6e-06 Identities = 25/36 (69%), Positives = 29/36 (80%) Frame = -1 Query: 503 GTCLMSKGNPLGVKALARTPAKPHRSYSEAEGKRAS 396 G CL SK NPLGVK L RTPAKPH+++S AEG R+S Sbjct: 424 GICLASKNNPLGVKMLKRTPAKPHQAFSGAEGGRSS 459