BLASTX nr result
ID: Cornus23_contig00037511
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00037511 (265 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007839860.1| hypothetical protein PFICI_13088 [Pestalotio... 80 6e-13 >ref|XP_007839860.1| hypothetical protein PFICI_13088 [Pestalotiopsis fici W106-1] gi|573054669|gb|ETS74604.1| hypothetical protein PFICI_13088 [Pestalotiopsis fici W106-1] Length = 295 Score = 80.1 bits (196), Expect = 6e-13 Identities = 34/43 (79%), Positives = 38/43 (88%) Frame = -2 Query: 264 VRDRCGGCKPNAVDVSEIIFDDLVGGTGDGRVQVEWYFNSGKW 136 VRDRCGGC NA+DV+E IFDDLVGGT GRV+VEWYFNSG+W Sbjct: 253 VRDRCGGCVENAIDVAETIFDDLVGGTTAGRVEVEWYFNSGEW 295