BLASTX nr result
ID: Cornus23_contig00027110
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00027110 (550 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP... 56 4e-08 ref|YP_009122770.1| ycf15 protein (chloroplast) [Dendropanax den... 56 1e-05 sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized p... 56 1e-05 ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus... 56 1e-05 >ref|YP_002720156.1| ORF126 [Jatropha curcas] gi|225544183|ref|YP_002720173.1| ORF126 [Jatropha curcas] gi|224979608|gb|ACN72735.1| ORF126 [Jatropha curcas] gi|224979624|gb|ACN72751.1| ORF126 [Jatropha curcas] Length = 126 Score = 55.8 bits (133), Expect(2) = 4e-08 Identities = 24/29 (82%), Positives = 25/29 (86%) Frame = +2 Query: 341 LPLPKWVLWGRVNSIIDACWHSSLPSPFR 427 +P KWVL GRVNSIID CWHSSLPSPFR Sbjct: 67 VPKRKWVLSGRVNSIIDVCWHSSLPSPFR 95 Score = 28.5 bits (62), Expect(2) = 4e-08 Identities = 13/16 (81%), Positives = 13/16 (81%) Frame = +1 Query: 307 RLTHSVTLALDAPAPK 354 RLTHSVTLALD P K Sbjct: 56 RLTHSVTLALDVPKRK 71 >ref|YP_009122770.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gi|788229267|ref|YP_009122787.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gi|902686955|ref|YP_009159582.1| Ycf15 (chloroplast) [Dendropanax morbifer] gi|902686973|ref|YP_009159600.1| Ycf15 (chloroplast) [Dendropanax morbifer] gi|755571763|gb|AJK29899.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gi|755571764|gb|AJK29900.1| ycf15 protein (chloroplast) [Dendropanax dentiger] gi|883743837|gb|AKQ20772.1| Ycf15 (chloroplast) [Dendropanax morbifer] gi|883743855|gb|AKQ20790.1| Ycf15 (chloroplast) [Dendropanax morbifer] Length = 100 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 423 KGDGRLECQQASIMEFTRPHSTHFGSGSVQCQSH 322 + +GRLECQQASI+EFTRP STHF G+VQCQSH Sbjct: 69 ESEGRLECQQASIIEFTRPDSTHF--GNVQCQSH 100 >sp|Q68RU5.1|YCF15_PANGI RecName: Full=Putative uncharacterized protein ycf15 (chloroplast) [Panax ginseng] gi|51235357|gb|AAT98553.1| ycf15 protein (chloroplast) [Panax ginseng] gi|51235376|gb|AAT98572.1| ycf15 protein (chloroplast) [Panax ginseng] gi|506444470|gb|AGM15032.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444471|gb|AGM15033.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444558|gb|AGM15118.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444559|gb|AGM15119.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444674|gb|AGM15204.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|506444675|gb|AGM15205.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|545484772|gb|AGW31964.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|545484773|gb|AGW31965.1| putative protein precursor Ycf15 (chloroplast) [Panax ginseng] gi|723604834|gb|AIX98613.1| Ycf15 (chloroplast) [Panax ginseng] gi|723604852|gb|AIX98631.1| Ycf15 (chloroplast) [Panax ginseng] gi|917544210|gb|AKZ29792.1| hypothetical chloroplast RF15 (chloroplast) [Panax quinquefolius] gi|917544227|gb|AKZ29809.1| hypothetical chloroplast RF15 (chloroplast) [Panax quinquefolius] Length = 100 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 423 KGDGRLECQQASIMEFTRPHSTHFGSGSVQCQSH 322 + +GRLECQQASI+EFTRP STHF G+VQCQSH Sbjct: 69 ESEGRLECQQASIIEFTRPDSTHF--GNVQCQSH 100 >ref|YP_004935597.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|359422209|ref|YP_004935614.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|558602956|ref|YP_008814988.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558602975|ref|YP_008815005.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|558603044|ref|YP_008815075.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603063|ref|YP_008815092.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|558603132|ref|YP_008815162.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|558603151|ref|YP_008815179.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|563940429|ref|YP_008815249.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|563940448|ref|YP_008815266.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|761380033|ref|YP_009121218.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gi|761380050|ref|YP_009121235.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gi|910355836|ref|YP_009161724.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gi|910355854|ref|YP_009161741.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gi|347448271|gb|AEO92683.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|347448272|gb|AEO92684.1| ycf15 protein (chloroplast) [Eleutherococcus senticosus] gi|458599236|gb|AGG39087.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599255|gb|AGG39106.1| hypothetical chloroplast RF15 (chloroplast) [Brassaiopsis hainla] gi|458599415|gb|AGG39174.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599434|gb|AGG39193.1| hypothetical chloroplast RF15 (chloroplast) [Metapanax delavayi] gi|458599568|gb|AGG39261.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599587|gb|AGG39280.1| hypothetical chloroplast RF15 (chloroplast) [Schefflera delavayi] gi|458599656|gb|AGG39348.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|458599675|gb|AGG39367.1| hypothetical chloroplast RF15 (chloroplast) [Kalopanax septemlobus] gi|638920777|gb|AIA24372.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gi|638920794|gb|AIA24389.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gi|818214086|gb|AKG26645.1| Ycf15 (chloroplast) [Panax notoginseng] gi|902816305|gb|AKS10998.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gi|902816323|gb|AKS11016.1| hypothetical chloroplast RF15 (chloroplast) [Fatsia japonica] gi|913021658|gb|AKU70821.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] gi|913021676|gb|AKU70839.1| hypothetical chloroplast RF15 (chloroplast) [Panax notoginseng] Length = 100 Score = 56.2 bits (134), Expect = 1e-05 Identities = 26/34 (76%), Positives = 30/34 (88%) Frame = -2 Query: 423 KGDGRLECQQASIMEFTRPHSTHFGSGSVQCQSH 322 + +GRLECQQASI+EFTRP STHF G+VQCQSH Sbjct: 69 ESEGRLECQQASIIEFTRPDSTHF--GNVQCQSH 100