BLASTX nr result
ID: Cornus23_contig00023863
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00023863 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007207312.1| hypothetical protein PRUPE_ppa003714mg [Prun... 62 1e-07 gb|EMT20132.1| Laccase-4 [Aegilops tauschii] 61 3e-07 ref|XP_010101806.1| hypothetical protein L484_023595 [Morus nota... 61 4e-07 ref|XP_010245131.1| PREDICTED: laccase-17-like [Nelumbo nucifera] 61 4e-07 ref|XP_002520231.1| laccase, putative [Ricinus communis] gi|2235... 61 4e-07 ref|XP_014492078.1| PREDICTED: laccase-17-like [Vigna radiata va... 60 5e-07 ref|XP_014492021.1| PREDICTED: laccase-17-like [Vigna radiata va... 60 5e-07 ref|XP_014519508.1| PREDICTED: laccase-2-like [Vigna radiata var... 60 5e-07 gb|KRH46827.1| hypothetical protein GLYMA_08G359100 [Glycine max] 60 5e-07 dbj|BAS75168.1| Os01g0842400, partial [Oryza sativa Japonica Group] 60 5e-07 ref|XP_013708582.1| PREDICTED: laccase-17-like [Brassica napus] 60 5e-07 ref|XP_013606667.1| PREDICTED: laccase-17 [Brassica oleracea var... 60 5e-07 ref|XP_013613862.1| PREDICTED: laccase-17-like [Brassica olerace... 60 5e-07 gb|KOM37984.1| hypothetical protein LR48_Vigan03g136600 [Vigna a... 60 5e-07 gb|KOM26210.1| hypothetical protein LR48_Vigan238s004300 [Vigna ... 60 5e-07 ref|XP_010106521.1| hypothetical protein L484_025281 [Morus nota... 60 5e-07 ref|XP_010092993.1| hypothetical protein L484_007174 [Morus nota... 60 5e-07 ref|XP_012850420.1| PREDICTED: laccase-17-like [Erythranthe gutt... 60 5e-07 ref|XP_012831822.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-l... 60 5e-07 ref|XP_012465812.1| PREDICTED: laccase-17-like [Gossypium raimon... 60 5e-07 >ref|XP_007207312.1| hypothetical protein PRUPE_ppa003714mg [Prunus persica] gi|462402954|gb|EMJ08511.1| hypothetical protein PRUPE_ppa003714mg [Prunus persica] Length = 554 Score = 62.4 bits (150), Expect = 1e-07 Identities = 26/31 (83%), Positives = 29/31 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPGT 95 FNLVDPVERNTVG+PSGGW +RFLA+NPGT Sbjct: 512 FNLVDPVERNTVGVPSGGWVAIRFLADNPGT 542 >gb|EMT20132.1| Laccase-4 [Aegilops tauschii] Length = 144 Score = 61.2 bits (147), Expect = 3e-07 Identities = 24/34 (70%), Positives = 31/34 (91%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPGTSRT 104 FNL+DP+ERNTVG+P+GGW V+RF+A+NPG S T Sbjct: 76 FNLIDPIERNTVGVPAGGWVVIRFVADNPGCSDT 109 >ref|XP_010101806.1| hypothetical protein L484_023595 [Morus notabilis] gi|587901679|gb|EXB89943.1| hypothetical protein L484_023595 [Morus notabilis] Length = 558 Score = 60.8 bits (146), Expect = 4e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 487 FNLVDPVERNTVGVPSGGWTAIRFLADNPG 516 >ref|XP_010245131.1| PREDICTED: laccase-17-like [Nelumbo nucifera] Length = 589 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW VRFLA+NPG Sbjct: 518 FNLVDPVERNTVGVPSGGWVAVRFLADNPG 547 >ref|XP_002520231.1| laccase, putative [Ricinus communis] gi|223540577|gb|EEF42143.1| laccase, putative [Ricinus communis] Length = 580 Score = 60.8 bits (146), Expect = 4e-07 Identities = 26/30 (86%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW VRFLA+NPG Sbjct: 509 FNLVDPVERNTVGVPSGGWVAVRFLADNPG 538 >ref|XP_014492078.1| PREDICTED: laccase-17-like [Vigna radiata var. radiata] Length = 581 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 510 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 539 >ref|XP_014492021.1| PREDICTED: laccase-17-like [Vigna radiata var. radiata] Length = 578 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 507 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 536 >ref|XP_014519508.1| PREDICTED: laccase-2-like [Vigna radiata var. radiata] Length = 587 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 516 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 545 >gb|KRH46827.1| hypothetical protein GLYMA_08G359100 [Glycine max] Length = 608 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 537 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 566 >dbj|BAS75168.1| Os01g0842400, partial [Oryza sativa Japonica Group] Length = 141 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/44 (61%), Positives = 32/44 (72%), Gaps = 8/44 (18%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPGT--------SRTTW 110 FNLVDPVERNTVG+P+GGW +RFLA+NPG + TTW Sbjct: 70 FNLVDPVERNTVGVPAGGWVAIRFLADNPGVWFMHCHLEAHTTW 113 >ref|XP_013708582.1| PREDICTED: laccase-17-like [Brassica napus] Length = 573 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDP+ERNTVG+PSGGW +RFLA+NPG Sbjct: 502 FNLVDPIERNTVGVPSGGWAAIRFLADNPG 531 >ref|XP_013606667.1| PREDICTED: laccase-17 [Brassica oleracea var. oleracea] Length = 572 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDP+ERNTVG+PSGGW +RFLA+NPG Sbjct: 501 FNLVDPIERNTVGVPSGGWAAIRFLADNPG 530 >ref|XP_013613862.1| PREDICTED: laccase-17-like [Brassica oleracea var. oleracea] gi|923644749|ref|XP_013642465.1| PREDICTED: laccase-17-like [Brassica napus] Length = 572 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDP+ERNTVG+PSGGW +RFLA+NPG Sbjct: 501 FNLVDPIERNTVGVPSGGWAAIRFLADNPG 530 >gb|KOM37984.1| hypothetical protein LR48_Vigan03g136600 [Vigna angularis] Length = 579 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 508 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 537 >gb|KOM26210.1| hypothetical protein LR48_Vigan238s004300 [Vigna angularis] Length = 586 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 515 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 544 >ref|XP_010106521.1| hypothetical protein L484_025281 [Morus notabilis] gi|587923347|gb|EXC10697.1| hypothetical protein L484_025281 [Morus notabilis] Length = 577 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNT+G+PSGGW +RFLA+NPG Sbjct: 506 FNLVDPVERNTIGVPSGGWAAIRFLADNPG 535 >ref|XP_010092993.1| hypothetical protein L484_007174 [Morus notabilis] gi|587863465|gb|EXB53231.1| hypothetical protein L484_007174 [Morus notabilis] Length = 586 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 515 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 544 >ref|XP_012850420.1| PREDICTED: laccase-17-like [Erythranthe guttatus] Length = 580 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 509 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 538 >ref|XP_012831822.1| PREDICTED: LOW QUALITY PROTEIN: laccase-17-like [Erythranthe guttatus] Length = 536 Score = 60.5 bits (145), Expect = 5e-07 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDPVERNTVG+PSGGW +RFLA+NPG Sbjct: 465 FNLVDPVERNTVGVPSGGWVAIRFLADNPG 494 >ref|XP_012465812.1| PREDICTED: laccase-17-like [Gossypium raimondii] gi|763811978|gb|KJB78830.1| hypothetical protein B456_013G021400 [Gossypium raimondii] Length = 576 Score = 60.5 bits (145), Expect = 5e-07 Identities = 24/30 (80%), Positives = 28/30 (93%) Frame = +3 Query: 3 FNLVDPVERNTVGIPSGGWEVVRFLANNPG 92 FNLVDP+ERNTVG+PSGGW +RFLA+NPG Sbjct: 505 FNLVDPIERNTVGVPSGGWAAIRFLADNPG 534