BLASTX nr result
ID: Cornus23_contig00023679
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00023679 (506 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobrom... 87 6e-15 gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris... 71 3e-10 gb|KHN18952.1| hypothetical protein glysoja_036131 [Glycine soja] 63 7e-08 ref|XP_002509440.1| pentatricopeptide repeat-containing protein,... 63 7e-08 gb|ABR16782.1| unknown [Picea sitchensis] 57 4e-06 >ref|XP_007025554.1| Uncharacterized protein TCM_029816 [Theobroma cacao] gi|508780920|gb|EOY28176.1| Uncharacterized protein TCM_029816 [Theobroma cacao] Length = 44 Score = 86.7 bits (213), Expect = 6e-15 Identities = 37/44 (84%), Positives = 42/44 (95%) Frame = -2 Query: 319 MMVEFFLLGCTGVVVFLHGANFFFHVLTHHIAIRSLSFLGFVGW 188 MMVE F+LGCTGVVVFLHGANFFFH+L+ H+A+RSLSFLGFVGW Sbjct: 1 MMVELFVLGCTGVVVFLHGANFFFHILSQHLAVRSLSFLGFVGW 44 >gb|KMT04609.1| hypothetical protein BVRB_8g182630 [Beta vulgaris subsp. vulgaris] Length = 44 Score = 71.2 bits (173), Expect = 3e-10 Identities = 30/44 (68%), Positives = 37/44 (84%) Frame = -2 Query: 319 MMVEFFLLGCTGVVVFLHGANFFFHVLTHHIAIRSLSFLGFVGW 188 M+VE F+LGCTG+V+F HGA+ FH L H+A+RSLSFLGFVGW Sbjct: 1 MVVELFVLGCTGMVMFYHGAHVLFHALFSHVALRSLSFLGFVGW 44 >gb|KHN18952.1| hypothetical protein glysoja_036131 [Glycine soja] Length = 78 Score = 63.2 bits (152), Expect = 7e-08 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -2 Query: 316 MVEFFLLGCTGVVVFLHGANFFFHVLTHHIAIRSLS 209 M+E +LGCTGVVVFLHGA+FFFH LT HIA+RSLS Sbjct: 1 MMEVLVLGCTGVVVFLHGAHFFFHALTQHIALRSLS 36 >ref|XP_002509440.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223549339|gb|EEF50827.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 678 Score = 63.2 bits (152), Expect = 7e-08 Identities = 29/38 (76%), Positives = 34/38 (89%), Gaps = 2/38 (5%) Frame = -2 Query: 319 MMVEFFLLG--CTGVVVFLHGANFFFHVLTHHIAIRSL 212 M+VE F+LG CTGVV+FLHGANFFFHVL+HH+A RSL Sbjct: 1 MVVEIFVLGMGCTGVVMFLHGANFFFHVLSHHLAFRSL 38 >gb|ABR16782.1| unknown [Picea sitchensis] Length = 41 Score = 57.4 bits (137), Expect = 4e-06 Identities = 23/36 (63%), Positives = 31/36 (86%) Frame = -2 Query: 301 LLGCTGVVVFLHGANFFFHVLTHHIAIRSLSFLGFV 194 LLGCTGV+VF+HGANFFF+ + H+A+R+L+FL V Sbjct: 5 LLGCTGVIVFIHGANFFFNYICKHVAVRALTFLSHV 40