BLASTX nr result
ID: Cornus23_contig00019121
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00019121 (315 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008242766.1| PREDICTED: nuclear pore complex protein Nup2... 102 1e-19 ref|XP_007203963.1| hypothetical protein PRUPE_ppa000100mg [Prun... 102 1e-19 ref|XP_009344851.1| PREDICTED: nuclear pore complex protein Nup2... 100 3e-19 ref|XP_009364040.1| PREDICTED: nuclear pore complex protein Nup2... 100 3e-19 ref|XP_008385678.1| PREDICTED: nuclear pore complex protein Nup2... 100 3e-19 ref|XP_007013432.1| Uncharacterized protein isoform 1 [Theobroma... 100 4e-19 ref|XP_006351979.1| PREDICTED: nuclear pore complex protein Nup2... 99 1e-18 ref|XP_009593415.1| PREDICTED: nuclear pore complex protein Nup2... 96 1e-17 gb|KDO80264.1| hypothetical protein CISIN_1g0001931mg, partial [... 95 2e-17 ref|XP_006475834.1| PREDICTED: nuclear pore complex protein Nup2... 95 2e-17 ref|XP_004515149.1| PREDICTED: nuclear pore complex protein NUP2... 95 2e-17 ref|XP_004515148.1| PREDICTED: nuclear pore complex protein NUP2... 95 2e-17 ref|XP_010250099.1| PREDICTED: nuclear pore complex protein Nup2... 94 4e-17 ref|XP_010656423.1| PREDICTED: nuclear pore complex protein NUP2... 93 7e-17 ref|XP_010656422.1| PREDICTED: nuclear pore complex protein NUP2... 93 7e-17 ref|XP_012846439.1| PREDICTED: nuclear pore complex protein NUP2... 93 7e-17 ref|XP_010313691.1| PREDICTED: nuclear pore complex protein Nup2... 93 9e-17 emb|CDP10403.1| unnamed protein product [Coffea canephora] 92 2e-16 dbj|BAO49742.1| nuclear pore complex protein Nup205a [Nicotiana ... 92 2e-16 ref|XP_003625502.2| nuclear pore complex Nup205-like protein [Me... 91 3e-16 >ref|XP_008242766.1| PREDICTED: nuclear pore complex protein Nup205 [Prunus mume] Length = 1859 Score = 102 bits (254), Expect = 1e-19 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MV PKQLLST+ES LLGP+PP+PSQR+ELMHAIR+SLSSFQSL+SYP PKPSDRAQVQ Sbjct: 1 MVLPKQLLSTVESALLGPSPPSPSQRVELMHAIRNSLSSFQSLLSYPPPKPSDRAQVQ 58 >ref|XP_007203963.1| hypothetical protein PRUPE_ppa000100mg [Prunus persica] gi|462399494|gb|EMJ05162.1| hypothetical protein PRUPE_ppa000100mg [Prunus persica] Length = 1824 Score = 102 bits (254), Expect = 1e-19 Identities = 49/58 (84%), Positives = 55/58 (94%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MV PKQLLST+ES LLGP+PP+PSQR+ELMHAIR+SLSSFQSL+SYP PKPSDRAQVQ Sbjct: 1 MVLPKQLLSTVESALLGPSPPSPSQRVELMHAIRNSLSSFQSLLSYPPPKPSDRAQVQ 58 >ref|XP_009344851.1| PREDICTED: nuclear pore complex protein Nup205-like [Pyrus x bretschneideri] Length = 1884 Score = 100 bits (250), Expect = 3e-19 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MV PKQLL+TIES LLGP+PP+PSQR+ELMHAIR SLSSFQSL+SYP PKPSDRAQVQ Sbjct: 1 MVLPKQLLATIESALLGPSPPSPSQRVELMHAIRSSLSSFQSLLSYPPPKPSDRAQVQ 58 >ref|XP_009364040.1| PREDICTED: nuclear pore complex protein Nup205-like [Pyrus x bretschneideri] Length = 1884 Score = 100 bits (250), Expect = 3e-19 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MV PKQLL+TIES LLGP+PP+PSQR+ELMHAIR SLSSFQSL+SYP PKPSDRAQVQ Sbjct: 1 MVLPKQLLATIESALLGPSPPSPSQRVELMHAIRSSLSSFQSLLSYPPPKPSDRAQVQ 58 >ref|XP_008385678.1| PREDICTED: nuclear pore complex protein Nup205 [Malus domestica] Length = 1880 Score = 100 bits (250), Expect = 3e-19 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MV PKQLL+TIES LLGP+PP+PSQR+ELMHAIR SLSSFQSL+SYP PKPSDRAQVQ Sbjct: 1 MVLPKQLLATIESALLGPSPPSPSQRVELMHAIRSSLSSFQSLLSYPPPKPSDRAQVQ 58 >ref|XP_007013432.1| Uncharacterized protein isoform 1 [Theobroma cacao] gi|508783795|gb|EOY31051.1| Uncharacterized protein isoform 1 [Theobroma cacao] Length = 1885 Score = 100 bits (249), Expect = 4e-19 Identities = 49/58 (84%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLLSTIES LLGP+PPTP+QR+EL+HAIR SLSS QSL+SYP PKPSDRAQVQ Sbjct: 1 MVSPKQLLSTIESSLLGPSPPTPAQRVELLHAIRSSLSSLQSLLSYPPPKPSDRAQVQ 58 >ref|XP_006351979.1| PREDICTED: nuclear pore complex protein Nup205-like [Solanum tuberosum] Length = 1874 Score = 99.0 bits (245), Expect = 1e-18 Identities = 48/58 (82%), Positives = 52/58 (89%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPK LLS IES +LGPTPPTPS+RIEL+HAIRHSL SFQSL+SYP PKPSDR QVQ Sbjct: 1 MVSPKILLSLIESTVLGPTPPTPSERIELLHAIRHSLPSFQSLLSYPPPKPSDRVQVQ 58 >ref|XP_009593415.1| PREDICTED: nuclear pore complex protein Nup205 [Nicotiana tomentosiformis] Length = 1874 Score = 95.9 bits (237), Expect = 1e-17 Identities = 47/58 (81%), Positives = 50/58 (86%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVS K LLS IES LLGPTPPTPSQRIEL+HAIRHSL S Q+L+SYP PKPSDR QVQ Sbjct: 1 MVSAKNLLSLIESTLLGPTPPTPSQRIELLHAIRHSLPSLQNLLSYPPPKPSDRVQVQ 58 >gb|KDO80264.1| hypothetical protein CISIN_1g0001931mg, partial [Citrus sinensis] gi|641861577|gb|KDO80265.1| hypothetical protein CISIN_1g0001931mg, partial [Citrus sinensis] Length = 176 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVS KQLL+TIES LLGP+PP+P+QRIEL+HAI +SLSSF+SL+SYP PKPSDRAQVQ Sbjct: 1 MVSTKQLLATIESALLGPSPPSPAQRIELIHAIHNSLSSFKSLLSYPPPKPSDRAQVQ 58 >ref|XP_006475834.1| PREDICTED: nuclear pore complex protein Nup205-like [Citrus sinensis] Length = 1885 Score = 95.1 bits (235), Expect = 2e-17 Identities = 46/58 (79%), Positives = 54/58 (93%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVS KQLL+TIES LLGP+PP+P+QRIEL+HAI +SLSSF+SL+SYP PKPSDRAQVQ Sbjct: 1 MVSTKQLLATIESALLGPSPPSPAQRIELIHAIHNSLSSFKSLLSYPPPKPSDRAQVQ 58 >ref|XP_004515149.1| PREDICTED: nuclear pore complex protein NUP205 isoform X2 [Cicer arietinum] Length = 1876 Score = 95.1 bits (235), Expect = 2e-17 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLL+T+ES LLG +PPTPSQR++L+HAIR SL SFQSL+SYP PKPSDR+QVQ Sbjct: 1 MVSPKQLLATLESALLGSSPPTPSQRVQLLHAIRASLHSFQSLLSYPPPKPSDRSQVQ 58 >ref|XP_004515148.1| PREDICTED: nuclear pore complex protein NUP205 isoform X1 [Cicer arietinum] Length = 1884 Score = 95.1 bits (235), Expect = 2e-17 Identities = 45/58 (77%), Positives = 53/58 (91%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLL+T+ES LLG +PPTPSQR++L+HAIR SL SFQSL+SYP PKPSDR+QVQ Sbjct: 1 MVSPKQLLATLESALLGSSPPTPSQRVQLLHAIRASLHSFQSLLSYPPPKPSDRSQVQ 58 >ref|XP_010250099.1| PREDICTED: nuclear pore complex protein Nup205 [Nelumbo nucifera] Length = 1883 Score = 94.0 bits (232), Expect = 4e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSP+QLLSTIES LLGP+PPTP+QRIELMH IR SL S QSL+SYP PK SDR+QVQ Sbjct: 1 MVSPRQLLSTIESALLGPSPPTPAQRIELMHVIRKSLPSLQSLLSYPHPKASDRSQVQ 58 >ref|XP_010656423.1| PREDICTED: nuclear pore complex protein NUP205 isoform X2 [Vitis vinifera] Length = 1888 Score = 93.2 bits (230), Expect = 7e-17 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLLS IES LLGP+PPTP+Q +EL+HAIR SLSS QSL+S+P PKPSDRAQVQ Sbjct: 1 MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIRSSLSSLQSLLSFPPPKPSDRAQVQ 58 >ref|XP_010656422.1| PREDICTED: nuclear pore complex protein NUP205 isoform X1 [Vitis vinifera] gi|297738947|emb|CBI28192.3| unnamed protein product [Vitis vinifera] Length = 1889 Score = 93.2 bits (230), Expect = 7e-17 Identities = 46/58 (79%), Positives = 52/58 (89%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLLS IES LLGP+PPTP+Q +EL+HAIR SLSS QSL+S+P PKPSDRAQVQ Sbjct: 1 MVSPKQLLSIIESSLLGPSPPTPAQWVELIHAIRSSLSSLQSLLSFPPPKPSDRAQVQ 58 >ref|XP_012846439.1| PREDICTED: nuclear pore complex protein NUP205 [Erythranthe guttatus] gi|604318158|gb|EYU29796.1| hypothetical protein MIMGU_mgv1a000086mg [Erythranthe guttata] Length = 1864 Score = 93.2 bits (230), Expect = 7e-17 Identities = 46/58 (79%), Positives = 51/58 (87%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLLS IES LLG TPPT +QRIEL+HAIRHSL S ++L+SYP PKPSDRAQVQ Sbjct: 1 MVSPKQLLSVIESTLLGRTPPTAAQRIELIHAIRHSLPSLKALLSYPPPKPSDRAQVQ 58 >ref|XP_010313691.1| PREDICTED: nuclear pore complex protein Nup205 [Solanum lycopersicum] Length = 1874 Score = 92.8 bits (229), Expect = 9e-17 Identities = 46/58 (79%), Positives = 50/58 (86%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVS K LLS IES +L PTPPTPS+RIEL+HAIRHSL SFQSL+SYP PKPSDR QVQ Sbjct: 1 MVSLKILLSLIESTVLNPTPPTPSERIELLHAIRHSLPSFQSLLSYPPPKPSDRVQVQ 58 >emb|CDP10403.1| unnamed protein product [Coffea canephora] Length = 1878 Score = 91.7 bits (226), Expect = 2e-16 Identities = 43/57 (75%), Positives = 50/57 (87%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQV 4 MVSPKQLLST+E LLGP PPTP+QR+EL+HAIR SL S ++L+SYP PKPSDRAQV Sbjct: 1 MVSPKQLLSTVEESLLGPNPPTPAQRVELIHAIRQSLPSLRNLLSYPPPKPSDRAQV 57 >dbj|BAO49742.1| nuclear pore complex protein Nup205a [Nicotiana benthamiana] Length = 1874 Score = 91.7 bits (226), Expect = 2e-16 Identities = 45/58 (77%), Positives = 49/58 (84%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVS K LLS IES LLGPT PTPSQRIEL+HAIRHSL + Q+L+SYP PKPSDR QVQ Sbjct: 1 MVSAKNLLSLIESTLLGPTSPTPSQRIELLHAIRHSLPTLQNLLSYPPPKPSDRVQVQ 58 >ref|XP_003625502.2| nuclear pore complex Nup205-like protein [Medicago truncatula] gi|657379652|gb|AES81720.2| nuclear pore complex Nup205-like protein [Medicago truncatula] Length = 1883 Score = 91.3 bits (225), Expect = 3e-16 Identities = 45/58 (77%), Positives = 50/58 (86%) Frame = -1 Query: 174 MVSPKQLLSTIESVLLGPTPPTPSQRIELMHAIRHSLSSFQSLISYPLPKPSDRAQVQ 1 MVSPKQLLST+ES LLG +PPTPSQRIE++HAIR SL S QSL+SYP P SDRAQVQ Sbjct: 1 MVSPKQLLSTLESALLGSSPPTPSQRIEVLHAIRSSLQSIQSLLSYPPPNSSDRAQVQ 58