BLASTX nr result
ID: Cornus23_contig00015445
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015445 (378 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KHN03395.1| Vesicle-associated protein 2-2 [Glycine soja] 58 2e-06 >gb|KHN03395.1| Vesicle-associated protein 2-2 [Glycine soja] Length = 244 Score = 58.2 bits (139), Expect = 2e-06 Identities = 24/38 (63%), Positives = 31/38 (81%) Frame = -2 Query: 116 MSARLVDIQPRELKFTVTMQAQRLVPPDMICKDKFLVQ 3 M+ L+ I+P EL+F TMQAQR+ PPDM+CKDKFL+Q Sbjct: 1 MATHLLHIEPAELRFVFTMQAQRMAPPDMLCKDKFLIQ 38