BLASTX nr result
ID: Cornus23_contig00015299
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015299 (336 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|KJX94507.1| opsin 1 protein [Zymoseptoria brevis] 60 8e-07 ref|XP_003852704.1| hypothetical protein MYCGRDRAFT_104409 [Zymo... 60 8e-07 gb|EME48641.1| hypothetical protein DOTSEDRAFT_67622 [Dothistrom... 59 1e-06 gb|EKG15421.1| Rhodopsin bacterial [Macrophomina phaseolina MS6] 58 2e-06 dbj|GAM88384.1| hypothetical protein ANO11243_064170 [fungal sp.... 57 4e-06 ref|XP_007920089.1| hypothetical protein MYCFIDRAFT_54557 [Pseud... 57 4e-06 ref|XP_007579671.1| putative opsin-1 protein [Neofusicoccum parv... 57 5e-06 gb|EMF17816.1| family A G protein-coupled receptor-like protein ... 57 5e-06 ref|XP_013346755.1| hypothetical protein AUEXF2481DRAFT_26816 [A... 57 7e-06 >gb|KJX94507.1| opsin 1 protein [Zymoseptoria brevis] Length = 299 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 336 TPEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 TPEM+ D+GGFWA+GL+ EGAIRVGDDDEGA Sbjct: 269 TPEMHADLGGFWANGLNGEGAIRVGDDDEGA 299 >ref|XP_003852704.1| hypothetical protein MYCGRDRAFT_104409 [Zymoseptoria tritici IPO323] gi|339472585|gb|EGP87680.1| hypothetical protein MYCGRDRAFT_104409 [Zymoseptoria tritici IPO323] Length = 303 Score = 59.7 bits (143), Expect = 8e-07 Identities = 25/31 (80%), Positives = 29/31 (93%) Frame = -1 Query: 336 TPEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 TPEM+ D+GGFWA+GL+ EGAIRVGDDDEGA Sbjct: 273 TPEMHADLGGFWANGLNGEGAIRVGDDDEGA 303 >gb|EME48641.1| hypothetical protein DOTSEDRAFT_67622 [Dothistroma septosporum NZE10] Length = 306 Score = 59.3 bits (142), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE NVDIGGFW+HGL +EG IRVGDDDEGA Sbjct: 277 PETNVDIGGFWSHGLGSEGQIRVGDDDEGA 306 >gb|EKG15421.1| Rhodopsin bacterial [Macrophomina phaseolina MS6] Length = 312 Score = 58.2 bits (139), Expect = 2e-06 Identities = 21/30 (70%), Positives = 28/30 (93%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE N+++GG+W HGL+NEG+IR+GDDDEGA Sbjct: 283 PETNIEVGGYWTHGLTNEGSIRIGDDDEGA 312 >dbj|GAM88384.1| hypothetical protein ANO11243_064170 [fungal sp. No.11243] Length = 307 Score = 57.4 bits (137), Expect = 4e-06 Identities = 22/30 (73%), Positives = 27/30 (90%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE N+++GGFW HG+S EGAIRVGDDD+GA Sbjct: 278 PETNIEVGGFWTHGVSGEGAIRVGDDDDGA 307 >ref|XP_007920089.1| hypothetical protein MYCFIDRAFT_54557 [Pseudocercospora fijiensis CIRAD86] gi|452987522|gb|EME87277.1| hypothetical protein MYCFIDRAFT_54557 [Pseudocercospora fijiensis CIRAD86] Length = 299 Score = 57.4 bits (137), Expect = 4e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE NVD+GGFW++GLS EG IRVGDDDEGA Sbjct: 270 PETNVDVGGFWSNGLSGEGRIRVGDDDEGA 299 >ref|XP_007579671.1| putative opsin-1 protein [Neofusicoccum parvum UCRNP2] gi|485929468|gb|EOD52861.1| putative opsin-1 protein [Neofusicoccum parvum UCRNP2] Length = 312 Score = 57.0 bits (136), Expect = 5e-06 Identities = 22/30 (73%), Positives = 28/30 (93%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE NV++GG+WAHGL+NEG+I +GDDDEGA Sbjct: 283 PETNVEVGGYWAHGLTNEGSICIGDDDEGA 312 >gb|EMF17816.1| family A G protein-coupled receptor-like protein [Sphaerulina musiva SO2202] Length = 306 Score = 57.0 bits (136), Expect = 5e-06 Identities = 24/30 (80%), Positives = 27/30 (90%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE NVD+GGFW++GLS EG IRVGDDDEGA Sbjct: 277 PETNVDLGGFWSNGLSGEGRIRVGDDDEGA 306 >ref|XP_013346755.1| hypothetical protein AUEXF2481DRAFT_26816 [Aureobasidium subglaciale EXF-2481] gi|662541139|gb|KEQ98439.1| hypothetical protein AUEXF2481DRAFT_26816 [Aureobasidium subglaciale EXF-2481] Length = 298 Score = 56.6 bits (135), Expect = 7e-06 Identities = 23/30 (76%), Positives = 28/30 (93%) Frame = -1 Query: 333 PEMNVDIGGFWAHGLSNEGAIRVGDDDEGA 244 PE V++GGFWAHG+S+EGAIRVG+DDEGA Sbjct: 269 PETQVELGGFWAHGVSSEGAIRVGEDDEGA 298