BLASTX nr result
ID: Cornus23_contig00015290
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015290 (283 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] 57 7e-06 >emb|CAN67932.1| hypothetical protein VITISV_013913 [Vitis vinifera] Length = 2077 Score = 56.6 bits (135), Expect = 7e-06 Identities = 33/80 (41%), Positives = 43/80 (53%) Frame = -1 Query: 244 NWCCVTLGEVESISHLQVHCSAVQ*ELWALLFSLFRVERVIL*CENLS*SSWLCGKATV* 65 N CC+ E E+I+H+ VHCS + LW LL SLF V V+ + SW Sbjct: 1951 NRCCLCCVEEETINHILVHCSKTK-ILWDLLLSLFGVNWVMPFSVRDTLLSWYVSFKD-- 2007 Query: 64 TNARTVWKVASLLLFWSVWK 5 N R VW+ A L LFW++WK Sbjct: 2008 KNHRKVWRAAPLCLFWTIWK 2027