BLASTX nr result
ID: Cornus23_contig00015277
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015277 (469 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_010917723.1| PREDICTED: cysteine synthase [Elaeis guineen... 61 4e-07 ref|XP_009394263.1| PREDICTED: cysteine synthase [Musa acuminata... 61 4e-07 ref|XP_008797336.1| PREDICTED: cysteine synthase [Phoenix dactyl... 61 4e-07 ref|XP_010659934.1| PREDICTED: cysteine synthase [Vitis vinifera... 60 5e-07 ref|XP_010546615.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 60 5e-07 emb|CBI34221.3| unnamed protein product [Vitis vinifera] 60 5e-07 ref|XP_008388647.1| PREDICTED: cysteine synthase [Malus domestic... 60 6e-07 gb|KHN30477.1| Cysteine synthase [Glycine soja] gi|947130000|gb|... 60 8e-07 emb|CBI34225.3| unnamed protein product [Vitis vinifera] 60 8e-07 ref|XP_003633659.1| PREDICTED: cysteine synthase [Vitis vinifera... 60 8e-07 ref|XP_006288112.1| hypothetical protein CARUB_v10001344mg, part... 60 8e-07 ref|XP_003633660.1| PREDICTED: cysteine synthase isoform X3 [Vit... 60 8e-07 emb|CAN76754.1| hypothetical protein VITISV_031201 [Vitis vinifera] 60 8e-07 ref|XP_010550943.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 59 1e-06 ref|XP_010550942.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 59 1e-06 ref|XP_010546614.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 59 1e-06 ref|XP_010421664.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 59 1e-06 ref|XP_010421662.1| PREDICTED: bifunctional L-3-cyanoalanine syn... 59 1e-06 ref|XP_010256041.1| PREDICTED: cysteine synthase [Nelumbo nucife... 59 1e-06 ref|XP_006288111.1| hypothetical protein CARUB_v10001344mg, part... 59 1e-06 >ref|XP_010917723.1| PREDICTED: cysteine synthase [Elaeis guineensis] Length = 325 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 408 GSPYCCQVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 G+ +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 32 GARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLITPGK 70 >ref|XP_009394263.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis] gi|695014839|ref|XP_009394264.1| PREDICTED: cysteine synthase [Musa acuminata subsp. malaccensis] Length = 325 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 408 GSPYCCQVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 G+ +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 32 GARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLITPGK 70 >ref|XP_008797336.1| PREDICTED: cysteine synthase [Phoenix dactylifera] Length = 325 Score = 60.8 bits (146), Expect = 4e-07 Identities = 27/39 (69%), Positives = 32/39 (82%) Frame = -2 Query: 408 GSPYCCQVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 G+ +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 32 GARIAAKLEMMEPCSSVKDRIGYSMIADAEEKGLITPGK 70 >ref|XP_010659934.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416541|ref|XP_010659935.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416543|ref|XP_010659936.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416545|ref|XP_010659937.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416547|ref|XP_010659938.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416549|ref|XP_010659939.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416551|ref|XP_010659940.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|731416553|ref|XP_010659941.1| PREDICTED: cysteine synthase [Vitis vinifera] Length = 323 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMIKDAE+K LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMIKDAEDKGLITPGK 69 >ref|XP_010546615.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like [Tarenaya hassleriana] Length = 284 Score = 60.5 bits (145), Expect = 5e-07 Identities = 27/30 (90%), Positives = 28/30 (93%) Frame = -2 Query: 381 MMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 MMEPCSS KDR+GYSMIKDAEEK LITPGK Sbjct: 1 MMEPCSSVKDRIGYSMIKDAEEKGLITPGK 30 >emb|CBI34221.3| unnamed protein product [Vitis vinifera] Length = 342 Score = 60.5 bits (145), Expect = 5e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMIKDAE+K LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMIKDAEDKGLITPGK 69 >ref|XP_008388647.1| PREDICTED: cysteine synthase [Malus domestica] gi|694376002|ref|XP_009364552.1| PREDICTED: cysteine synthase [Pyrus x bretschneideri] Length = 325 Score = 60.1 bits (144), Expect = 6e-07 Identities = 26/33 (78%), Positives = 31/33 (93%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMIKDAEEK LITPG+ Sbjct: 38 KLEMMEPCSSVKDRIGYSMIKDAEEKGLITPGE 70 >gb|KHN30477.1| Cysteine synthase [Glycine soja] gi|947130000|gb|KRH77854.1| hypothetical protein GLYMA_01G237900 [Glycine max] Length = 74 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/34 (76%), Positives = 31/34 (91%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGKV 289 ++++MEPCSS KDR+GYSMI DAEEK LITPGKV Sbjct: 38 KLELMEPCSSVKDRIGYSMIADAEEKGLITPGKV 71 >emb|CBI34225.3| unnamed protein product [Vitis vinifera] Length = 128 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMINDAEEKGLITPGK 69 >ref|XP_003633659.1| PREDICTED: cysteine synthase [Vitis vinifera] gi|298204916|emb|CBI34223.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMINDAEEKGLITPGK 69 >ref|XP_006288112.1| hypothetical protein CARUB_v10001344mg, partial [Capsella rubella] gi|482556818|gb|EOA21010.1| hypothetical protein CARUB_v10001344mg, partial [Capsella rubella] Length = 342 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+ YSMIKDAEEK LITPGK Sbjct: 56 ELEMMEPCSSVKDRIAYSMIKDAEEKGLITPGK 88 >ref|XP_003633660.1| PREDICTED: cysteine synthase isoform X3 [Vitis vinifera] gi|731416562|ref|XP_010659944.1| PREDICTED: cysteine synthase isoform X4 [Vitis vinifera] gi|298204917|emb|CBI34224.3| unnamed protein product [Vitis vinifera] Length = 323 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMINDAEEKGLITPGK 69 >emb|CAN76754.1| hypothetical protein VITISV_031201 [Vitis vinifera] Length = 323 Score = 59.7 bits (143), Expect = 8e-07 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMINDAEEKGLITPGK 69 >ref|XP_010550943.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X2 [Tarenaya hassleriana] gi|729385228|ref|XP_010550944.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X2 [Tarenaya hassleriana] gi|729385231|ref|XP_010550945.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X2 [Tarenaya hassleriana] Length = 323 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIGYSMITDAEEKGLITPGK 69 >ref|XP_010550942.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X1 [Tarenaya hassleriana] Length = 353 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 67 KLEMMEPCSSVKDRIGYSMITDAEEKGLITPGK 99 >ref|XP_010546614.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like [Tarenaya hassleriana] Length = 324 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+ YSMIKDAEEK LITPGK Sbjct: 38 KLEMMEPCSSVKDRIAYSMIKDAEEKGLITPGK 70 >ref|XP_010421664.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X3 [Camelina sativa] gi|727491221|ref|XP_010421665.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X4 [Camelina sativa] Length = 319 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+ YSMIKDAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIAYSMIKDAEEKGLITPGK 69 >ref|XP_010421662.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X1 [Camelina sativa] gi|727491217|ref|XP_010421663.1| PREDICTED: bifunctional L-3-cyanoalanine synthase/cysteine synthase D2-like isoform X2 [Camelina sativa] Length = 323 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+ YSMIKDAEEK LITPGK Sbjct: 37 KLEMMEPCSSVKDRIAYSMIKDAEEKGLITPGK 69 >ref|XP_010256041.1| PREDICTED: cysteine synthase [Nelumbo nucifera] gi|720000492|ref|XP_010256042.1| PREDICTED: cysteine synthase [Nelumbo nucifera] gi|720000495|ref|XP_010256043.1| PREDICTED: cysteine synthase [Nelumbo nucifera] Length = 325 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+GYSMI DAEEK LITPGK Sbjct: 38 KLEMMEPCSSVKDRIGYSMIADAEEKGLITPGK 70 >ref|XP_006288111.1| hypothetical protein CARUB_v10001344mg, partial [Capsella rubella] gi|482556817|gb|EOA21009.1| hypothetical protein CARUB_v10001344mg, partial [Capsella rubella] Length = 337 Score = 59.3 bits (142), Expect = 1e-06 Identities = 26/33 (78%), Positives = 30/33 (90%) Frame = -2 Query: 390 QVKMMEPCSSAKDRVGYSMIKDAEEKALITPGK 292 +++MMEPCSS KDR+ YSMIKDAEEK LITPGK Sbjct: 80 KLEMMEPCSSVKDRIAYSMIKDAEEKGLITPGK 112