BLASTX nr result
ID: Cornus23_contig00015221
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015221 (740 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI28047.3| unnamed protein product [Vitis vinifera] 58 8e-06 >emb|CBI28047.3| unnamed protein product [Vitis vinifera] Length = 337 Score = 57.8 bits (138), Expect = 8e-06 Identities = 28/52 (53%), Positives = 32/52 (61%), Gaps = 2/52 (3%) Frame = -2 Query: 712 MLPRARTWVLKKACWCECWYWNMVW--LFGFEWQHVV*KASSGTWYSCIFCE 563 MLP R WVL+KACWCEC +W MVW LF FE + V K S Y + CE Sbjct: 61 MLPGTRIWVLRKACWCECGFWEMVWVNLFWFEGKRVCGKCSCEISY--MLCE 110