BLASTX nr result
ID: Cornus23_contig00015209
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00015209 (363 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus tr... 57 4e-06 >ref|YP_001109551.1| hypothetical protein Poptr_cp073 [Populus trichocarpa] gi|134093267|ref|YP_001109568.1| hypothetical protein Poptr_cp090 [Populus trichocarpa] gi|133712112|gb|ABO36755.1| conserved hypothetical protein [Populus trichocarpa] gi|133712129|gb|ABO36772.1| conserved hypothetical protein [Populus trichocarpa] Length = 86 Score = 57.4 bits (137), Expect = 4e-06 Identities = 28/39 (71%), Positives = 33/39 (84%) Frame = +1 Query: 58 LVKI*KKRNLSIFQYLKGAYKHIRTLEWKWKWKRYITPI 174 LV + KKRNLSIF+ LKGA+KHIRTLE WKWKR +TP+ Sbjct: 22 LVCVPKKRNLSIFRGLKGAWKHIRTLE--WKWKRDVTPV 58