BLASTX nr result
ID: Cornus23_contig00005361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00005361 (309 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_008240910.1| PREDICTED: thioredoxin-like 3-1, chloroplast... 61 4e-07 ref|XP_007202632.1| hypothetical protein PRUPE_ppa012043mg [Prun... 61 4e-07 ref|XP_007029026.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cac... 59 1e-06 ref|XP_007029025.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cac... 59 1e-06 >ref|XP_008240910.1| PREDICTED: thioredoxin-like 3-1, chloroplastic [Prunus mume] Length = 186 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +2 Query: 125 MSILAPNSNILCREICHRKEQPQQFW-SGGSCLVLLNSHGFGFDRSKADQWKKIAKRDFR 301 MS+LA NS+ILCRE+ HR+ Q QQFW SGGS L+ S GFG D KK+ K DF+ Sbjct: 1 MSVLAANSHILCREMHHREHQ-QQFWISGGSLLLRKASSGFGLLNRNRDDGKKMMKWDFK 59 Query: 302 VD 307 V+ Sbjct: 60 VE 61 >ref|XP_007202632.1| hypothetical protein PRUPE_ppa012043mg [Prunus persica] gi|462398163|gb|EMJ03831.1| hypothetical protein PRUPE_ppa012043mg [Prunus persica] Length = 186 Score = 60.8 bits (146), Expect = 4e-07 Identities = 34/62 (54%), Positives = 42/62 (67%), Gaps = 1/62 (1%) Frame = +2 Query: 125 MSILAPNSNILCREICHRKEQPQQFW-SGGSCLVLLNSHGFGFDRSKADQWKKIAKRDFR 301 MS+LA NS+ILCRE+ HR+ Q QQFW SGGS L+ S GFG D KK+ K DF+ Sbjct: 1 MSVLAANSHILCREMHHREHQ-QQFWISGGSLLLRKASSGFGLLNRNRDDGKKMLKWDFK 59 Query: 302 VD 307 V+ Sbjct: 60 VE 61 >ref|XP_007029026.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cacao] gi|508717631|gb|EOY09528.1| WCRKC thioredoxin 1 isoform 2 [Theobroma cacao] Length = 139 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +2 Query: 125 MSILAPNSNILCREICHRKEQPQQFWSGGSCLVLLNSHG-FGFDRSKADQWKKIAKRDFR 301 MS+LA NS IL RE ++++Q QQ W+ GSC++L + G FGFDR K IA+RD+R Sbjct: 1 MSVLAANSQILYREF-YQRDQQQQLWNSGSCMLLQKNCGYFGFDRRNGKWKKNIARRDWR 59 Query: 302 VD 307 V+ Sbjct: 60 VE 61 >ref|XP_007029025.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cacao] gi|508717630|gb|EOY09527.1| WCRKC thioredoxin 1 isoform 1 [Theobroma cacao] Length = 187 Score = 59.3 bits (142), Expect = 1e-06 Identities = 31/62 (50%), Positives = 43/62 (69%), Gaps = 1/62 (1%) Frame = +2 Query: 125 MSILAPNSNILCREICHRKEQPQQFWSGGSCLVLLNSHG-FGFDRSKADQWKKIAKRDFR 301 MS+LA NS IL RE ++++Q QQ W+ GSC++L + G FGFDR K IA+RD+R Sbjct: 1 MSVLAANSQILYREF-YQRDQQQQLWNSGSCMLLQKNCGYFGFDRRNGKWKKNIARRDWR 59 Query: 302 VD 307 V+ Sbjct: 60 VE 61