BLASTX nr result
ID: Cornus23_contig00005001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Cornus23_contig00005001 (365 letters) Database: ./nr 77,306,371 sequences; 28,104,191,420 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CDP19616.1| unnamed protein product [Coffea canephora] 59 2e-06 dbj|BAG80535.1| putative glycosyltransferase [Lycium barbarum] 58 3e-06 ref|XP_011094571.1| PREDICTED: UDP-glycosyltransferase 73C5 [Ses... 57 4e-06 ref|XP_009796872.1| PREDICTED: UDP-glycosyltransferase 73C2-like... 56 9e-06 ref|XP_009623864.1| PREDICTED: UDP-glycosyltransferase 73C3-like... 56 9e-06 >emb|CDP19616.1| unnamed protein product [Coffea canephora] Length = 487 Score = 58.5 bits (140), Expect = 2e-06 Identities = 27/30 (90%), Positives = 29/30 (96%) Frame = -3 Query: 90 MACKHQLHFILFPLMAPGHMIPMIDIAKLL 1 MA ++QLHFILFPLMAPGHMIPMIDIAKLL Sbjct: 1 MASQNQLHFILFPLMAPGHMIPMIDIAKLL 30 >dbj|BAG80535.1| putative glycosyltransferase [Lycium barbarum] Length = 503 Score = 57.8 bits (138), Expect = 3e-06 Identities = 26/26 (100%), Positives = 26/26 (100%) Frame = -3 Query: 78 HQLHFILFPLMAPGHMIPMIDIAKLL 1 HQLHFILFPLMAPGHMIPMIDIAKLL Sbjct: 7 HQLHFILFPLMAPGHMIPMIDIAKLL 32 >ref|XP_011094571.1| PREDICTED: UDP-glycosyltransferase 73C5 [Sesamum indicum] Length = 492 Score = 57.4 bits (137), Expect = 4e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 78 HQLHFILFPLMAPGHMIPMIDIAKLL 1 HQLHF+LFPLMAPGHMIPMIDIAKLL Sbjct: 6 HQLHFVLFPLMAPGHMIPMIDIAKLL 31 >ref|XP_009796872.1| PREDICTED: UDP-glycosyltransferase 73C2-like [Nicotiana sylvestris] Length = 496 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 78 HQLHFILFPLMAPGHMIPMIDIAKLL 1 H+LHFILFPLMAPGHMIPMIDIAKLL Sbjct: 6 HKLHFILFPLMAPGHMIPMIDIAKLL 31 >ref|XP_009623864.1| PREDICTED: UDP-glycosyltransferase 73C3-like [Nicotiana tomentosiformis] gi|62241063|dbj|BAD93688.1| glucosyltransferase [Nicotiana tabacum] Length = 496 Score = 56.2 bits (134), Expect = 9e-06 Identities = 25/26 (96%), Positives = 26/26 (100%) Frame = -3 Query: 78 HQLHFILFPLMAPGHMIPMIDIAKLL 1 H+LHFILFPLMAPGHMIPMIDIAKLL Sbjct: 6 HKLHFILFPLMAPGHMIPMIDIAKLL 31