BLASTX nr result
ID: Coptis25_contig00042903
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00042903 (268 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002517715.1| nuclease, putative [Ricinus communis] gi|223... 93 3e-17 ref|XP_002325655.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 ref|XP_002319418.1| predicted protein [Populus trichocarpa] gi|2... 92 6e-17 ref|XP_004145233.1| PREDICTED: uncharacterized protein LOC101203... 86 3e-15 ref|NP_180594.2| GIY-YIG catalytic domain-containing protein [Ar... 85 5e-15 >ref|XP_002517715.1| nuclease, putative [Ricinus communis] gi|223543113|gb|EEF44647.1| nuclease, putative [Ricinus communis] Length = 413 Score = 92.8 bits (229), Expect = 3e-17 Identities = 42/48 (87%), Positives = 44/48 (91%) Frame = -2 Query: 144 GFYACYLLSSLCSRFKGHTYIGFTVNPRRRIRQHNGEITSGARRTKSK 1 GFYACYLL+SLC RFKGHTYIGFTVNPRRRIRQHNGEI SGA RTK + Sbjct: 26 GFYACYLLTSLCPRFKGHTYIGFTVNPRRRIRQHNGEIRSGAFRTKKR 73 >ref|XP_002325655.1| predicted protein [Populus trichocarpa] gi|222862530|gb|EEF00037.1| predicted protein [Populus trichocarpa] Length = 207 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -2 Query: 150 KAGFYACYLLSSLCSRFKGHTYIGFTVNPRRRIRQHNGEITSGARRTKSK 1 K GF+ACYLL+SLC RFKGHTYIGFTVNPRRRIRQHNGE+ SGA RTK + Sbjct: 24 KNGFFACYLLTSLCPRFKGHTYIGFTVNPRRRIRQHNGELRSGACRTKKR 73 >ref|XP_002319418.1| predicted protein [Populus trichocarpa] gi|222857794|gb|EEE95341.1| predicted protein [Populus trichocarpa] Length = 192 Score = 91.7 bits (226), Expect = 6e-17 Identities = 41/50 (82%), Positives = 45/50 (90%) Frame = -2 Query: 150 KAGFYACYLLSSLCSRFKGHTYIGFTVNPRRRIRQHNGEITSGARRTKSK 1 K GF+ACYLL+SLC RFKGHTYIGFTVNPRRRIRQHNGE+ SGA RTK + Sbjct: 9 KNGFFACYLLTSLCPRFKGHTYIGFTVNPRRRIRQHNGELRSGACRTKKR 58 >ref|XP_004145233.1| PREDICTED: uncharacterized protein LOC101203492 [Cucumis sativus] gi|449471301|ref|XP_004153269.1| PREDICTED: uncharacterized protein LOC101204996 [Cucumis sativus] gi|449506301|ref|XP_004162709.1| PREDICTED: uncharacterized protein LOC101229010 [Cucumis sativus] Length = 395 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/48 (79%), Positives = 42/48 (87%) Frame = -2 Query: 144 GFYACYLLSSLCSRFKGHTYIGFTVNPRRRIRQHNGEITSGARRTKSK 1 GF++CYLL+S C RFKGHTYIGFTVNP+RRIRQHNGEI GA RTK K Sbjct: 32 GFFSCYLLASACPRFKGHTYIGFTVNPKRRIRQHNGEIRCGAWRTKRK 79 >ref|NP_180594.2| GIY-YIG catalytic domain-containing protein [Arabidopsis thaliana] gi|51968920|dbj|BAD43152.1| hypothetical protein [Arabidopsis thaliana] gi|51968928|dbj|BAD43156.1| hypothetical protein [Arabidopsis thaliana] gi|51971411|dbj|BAD44370.1| hypothetical protein [Arabidopsis thaliana] gi|66792676|gb|AAY56440.1| At2g30350 [Arabidopsis thaliana] gi|330253280|gb|AEC08374.1| GIY-YIG catalytic domain-containing protein [Arabidopsis thaliana] Length = 368 Score = 85.1 bits (209), Expect = 5e-15 Identities = 40/48 (83%), Positives = 42/48 (87%) Frame = -2 Query: 144 GFYACYLLSSLCSRFKGHTYIGFTVNPRRRIRQHNGEITSGARRTKSK 1 GF+ACYLL+SL R KG TYIGFTVNPRRRIRQHNGEITSGA RTK K Sbjct: 26 GFFACYLLTSLSPRHKGQTYIGFTVNPRRRIRQHNGEITSGAWRTKKK 73