BLASTX nr result
ID: Coptis25_contig00033361
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00033361 (535 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_717167.1| hypothetical protein BrnapMp071 [Brassica napus... 65 6e-09 >ref|YP_717167.1| hypothetical protein BrnapMp071 [Brassica napus] gi|353526419|ref|YP_004927491.1| orf101e (mitochondrion) [Brassica oleracea] gi|353526674|ref|YP_004927843.1| orf101e (mitochondrion) [Brassica rapa subsp. campestris] gi|353531357|ref|YP_004927746.1| orf101e (mitochondrion) [Brassica juncea] gi|37591115|dbj|BAC98917.1| hypothetical protein [Brassica napus] gi|335354862|gb|AEH43418.1| orf101e [Brassica rapa subsp. campestris] gi|335354964|gb|AEH43519.1| orf101e [Brassica oleracea] gi|335355090|gb|AEH43643.1| orf101e [Brassica juncea] gi|339511289|emb|CBX48344.1| unnamed protein product [Brassica napus] Length = 101 Score = 65.1 bits (157), Expect = 6e-09 Identities = 37/53 (69%), Positives = 41/53 (77%), Gaps = 8/53 (15%) Frame = -1 Query: 136 SMVINLILH-------PVG-TVFMVVPVRIYVDGAFGSHPRSSI*SSYLLFPA 2 S+ ++LI+H P G TVFMVVPVRIYVDGAFGSHPR SI SSYLLFPA Sbjct: 13 SIGLDLIIHGHKSDSSPSGNTVFMVVPVRIYVDGAFGSHPRFSIQSSYLLFPA 65 Score = 56.2 bits (134), Expect = 3e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -3 Query: 182 DLIVDFHQSIGLDLLIHGHKSDSSPSGNSL 93 D VDFHQSIGLDL+IHGHKSDSSPSGN++ Sbjct: 5 DRRVDFHQSIGLDLIIHGHKSDSSPSGNTV 34