BLASTX nr result
ID: Coptis25_contig00025555
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00025555 (328 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] 72 6e-11 ref|XP_002521029.1| conserved hypothetical protein [Ricinus comm... 71 1e-10 ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago ... 59 4e-07 >emb|CAN78770.1| hypothetical protein VITISV_024249 [Vitis vinifera] Length = 77 Score = 71.6 bits (174), Expect = 6e-11 Identities = 35/65 (53%), Positives = 53/65 (81%), Gaps = 1/65 (1%) Frame = +2 Query: 98 REMSSRNSQRRKVVRKSLRTKVRRLQRIVPGGHGLEPGRLFLQTANYILHLKLQVN-MLQ 274 +EMS +RR+ R+S+R KV++LQR++PGG GL+P RLFL+TA+YILHL+LQ+ +L Sbjct: 7 KEMSGEKLRRRR--RRSVRRKVKKLQRLIPGGRGLQPDRLFLRTADYILHLRLQMGILLY 64 Query: 275 ALSMM 289 A++M+ Sbjct: 65 AVTML 69 >ref|XP_002521029.1| conserved hypothetical protein [Ricinus communis] gi|223539866|gb|EEF41446.1| conserved hypothetical protein [Ricinus communis] Length = 89 Score = 70.9 bits (172), Expect = 1e-10 Identities = 35/68 (51%), Positives = 50/68 (73%), Gaps = 5/68 (7%) Frame = +2 Query: 104 MSSRNSQRRK-----VVRKSLRTKVRRLQRIVPGGHGLEPGRLFLQTANYILHLKLQVNM 268 M R +RR+ S++ +V++LQR++PGG L+P RLFL+TA+YILHL+LQVN+ Sbjct: 19 MGRRRRRRRRRGAATATTTSIQMRVKKLQRLIPGGEELQPDRLFLRTADYILHLELQVNV 78 Query: 269 LQALSMMY 292 LQALS +Y Sbjct: 79 LQALSEIY 86 >ref|XP_003589440.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|357516789|ref|XP_003628683.1| hypothetical protein MTR_8g063410 [Medicago truncatula] gi|355478488|gb|AES59691.1| hypothetical protein MTR_1g024370 [Medicago truncatula] gi|355522705|gb|AET03159.1| hypothetical protein MTR_8g063410 [Medicago truncatula] Length = 72 Score = 58.9 bits (141), Expect = 4e-07 Identities = 29/64 (45%), Positives = 48/64 (75%) Frame = +2 Query: 101 EMSSRNSQRRKVVRKSLRTKVRRLQRIVPGGHGLEPGRLFLQTANYILHLKLQVNMLQAL 280 +M + +RR+V ++ K+++LQRI+PGG GL+ +LFL+TA +IL L+LQ+N LQAL Sbjct: 10 KMKLKRRRRREV---AVGRKMKKLQRIIPGGDGLKADQLFLRTAEHILQLRLQLNALQAL 66 Query: 281 SMMY 292 + ++ Sbjct: 67 TKIF 70