BLASTX nr result
ID: Coptis25_contig00014836
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014836 (277 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003519264.1| PREDICTED: uncharacterized protein LOC100801... 61 1e-07 ref|XP_002888748.1| hypothetical protein ARALYDRAFT_476125 [Arab... 61 1e-07 ref|XP_004135213.1| PREDICTED: uncharacterized protein LOC101207... 59 3e-07 gb|AAB61114.1| EST gb|ATTS0887 comes from this gene [Arabidopsis... 59 3e-07 ref|NP_564982.1| uncharacterized protein [Arabidopsis thaliana] ... 59 3e-07 >ref|XP_003519264.1| PREDICTED: uncharacterized protein LOC100801656 [Glycine max] Length = 219 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/36 (75%), Positives = 28/36 (77%) Frame = -2 Query: 108 VERRSLLSFKETQKGGNVTFECTPSGPCISCHYSEK 1 V RR LLSFKE G NVTFECTPSGPC+ C YSEK Sbjct: 43 VRRRVLLSFKEKPSGSNVTFECTPSGPCVPCLYSEK 78 >ref|XP_002888748.1| hypothetical protein ARALYDRAFT_476125 [Arabidopsis lyrata subsp. lyrata] gi|297334589|gb|EFH65007.1| hypothetical protein ARALYDRAFT_476125 [Arabidopsis lyrata subsp. lyrata] Length = 202 Score = 60.8 bits (146), Expect = 1e-07 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -2 Query: 114 KEVERRSLLSFKETQKGGNVTFECTPSGPCISCHYSEK 1 + V RR LLSFKET KG N+TF C+PSGPC+SC+ SEK Sbjct: 40 RSVGRRLLLSFKETPKGSNITFACSPSGPCVSCNSSEK 77 >ref|XP_004135213.1| PREDICTED: uncharacterized protein LOC101207563 [Cucumis sativus] gi|449478498|ref|XP_004155334.1| PREDICTED: uncharacterized LOC101207563 [Cucumis sativus] Length = 214 Score = 59.3 bits (142), Expect = 3e-07 Identities = 32/60 (53%), Positives = 40/60 (66%), Gaps = 12/60 (20%) Frame = -2 Query: 144 FSIPLQRRSQ--------KEVE----RRSLLSFKETQKGGNVTFECTPSGPCISCHYSEK 1 FS L +SQ +E+E RR+LLSFKET +G NVTFEC+ SGPC++C YSEK Sbjct: 17 FSASLHAQSQNTDRVGGDEEIEIGFGRRALLSFKETPQGSNVTFECSRSGPCVACLYSEK 76 >gb|AAB61114.1| EST gb|ATTS0887 comes from this gene [Arabidopsis thaliana] Length = 358 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 114 KEVERRSLLSFKETQKGGNVTFECTPSGPCISCHYSEK 1 + V RR LL FKET KG N+TF C+PSGPC+SC+ SEK Sbjct: 178 RSVGRRFLLGFKETPKGSNITFACSPSGPCVSCNSSEK 215 >ref|NP_564982.1| uncharacterized protein [Arabidopsis thaliana] gi|119360057|gb|ABL66757.1| At1g69980 [Arabidopsis thaliana] gi|332196884|gb|AEE35005.1| uncharacterized protein [Arabidopsis thaliana] Length = 205 Score = 59.3 bits (142), Expect = 3e-07 Identities = 25/38 (65%), Positives = 30/38 (78%) Frame = -2 Query: 114 KEVERRSLLSFKETQKGGNVTFECTPSGPCISCHYSEK 1 + V RR LL FKET KG N+TF C+PSGPC+SC+ SEK Sbjct: 40 RSVGRRFLLGFKETPKGSNITFACSPSGPCVSCNSSEK 77