BLASTX nr result
ID: Coptis25_contig00014593
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00014593 (515 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002311188.1| predicted protein [Populus trichocarpa] gi|2... 97 1e-18 emb|CBI31619.3| unnamed protein product [Vitis vinifera] 96 3e-18 ref|XP_002282470.1| PREDICTED: X-linked retinitis pigmentosa GTP... 96 3e-18 ref|XP_003600757.1| RCC1 and BTB domain-containing protein [Medi... 95 5e-18 ref|XP_003600756.1| RCC1 and BTB domain-containing protein [Medi... 95 5e-18 >ref|XP_002311188.1| predicted protein [Populus trichocarpa] gi|222851008|gb|EEE88555.1| predicted protein [Populus trichocarpa] Length = 148 Score = 97.1 bits (240), Expect = 1e-18 Identities = 41/48 (85%), Positives = 44/48 (91%) Frame = +3 Query: 3 WGWNKYGQLGLGDLIDRNTPSQVPMDGHLSKNVACGWWHTLLLAESPT 146 WGWNKYGQLGLGD+IDRN PSQV +DG + KNVACGWWHTLLLAESPT Sbjct: 101 WGWNKYGQLGLGDVIDRNVPSQVTIDGCVPKNVACGWWHTLLLAESPT 148 >emb|CBI31619.3| unnamed protein product [Vitis vinifera] Length = 461 Score = 95.9 bits (237), Expect = 3e-18 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 WGWNKYGQLGLGDLIDRNTPSQVPMDGHLSKNVACGWWHTLLLAESPT 146 WGWNKYGQLGLGD++DRN PSQV +DG KNVACGWWHTLLLAESPT Sbjct: 414 WGWNKYGQLGLGDVVDRNIPSQVTLDGCTPKNVACGWWHTLLLAESPT 461 >ref|XP_002282470.1| PREDICTED: X-linked retinitis pigmentosa GTPase regulator [Vitis vinifera] Length = 484 Score = 95.9 bits (237), Expect = 3e-18 Identities = 40/48 (83%), Positives = 43/48 (89%) Frame = +3 Query: 3 WGWNKYGQLGLGDLIDRNTPSQVPMDGHLSKNVACGWWHTLLLAESPT 146 WGWNKYGQLGLGD++DRN PSQV +DG KNVACGWWHTLLLAESPT Sbjct: 437 WGWNKYGQLGLGDVVDRNIPSQVTLDGCTPKNVACGWWHTLLLAESPT 484 >ref|XP_003600757.1| RCC1 and BTB domain-containing protein [Medicago truncatula] gi|355489805|gb|AES71008.1| RCC1 and BTB domain-containing protein [Medicago truncatula] Length = 260 Score = 95.1 bits (235), Expect = 5e-18 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +3 Query: 3 WGWNKYGQLGLGDLIDRNTPSQVPMDGHLSKNVACGWWHTLLLAESPT 146 WGWNKYGQLGLGD+IDRN PS+V ++G ++KNVACGWWHTLLLAESPT Sbjct: 213 WGWNKYGQLGLGDVIDRNIPSEVAIEGCIAKNVACGWWHTLLLAESPT 260 >ref|XP_003600756.1| RCC1 and BTB domain-containing protein [Medicago truncatula] gi|355489804|gb|AES71007.1| RCC1 and BTB domain-containing protein [Medicago truncatula] Length = 464 Score = 95.1 bits (235), Expect = 5e-18 Identities = 39/48 (81%), Positives = 45/48 (93%) Frame = +3 Query: 3 WGWNKYGQLGLGDLIDRNTPSQVPMDGHLSKNVACGWWHTLLLAESPT 146 WGWNKYGQLGLGD+IDRN PS+V ++G ++KNVACGWWHTLLLAESPT Sbjct: 417 WGWNKYGQLGLGDVIDRNIPSEVAIEGCIAKNVACGWWHTLLLAESPT 464