BLASTX nr result
ID: Coptis25_contig00010326
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010326 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN62023.1| hypothetical protein VITISV_005083 [Vitis vinifera] 69 1e-17 ref|XP_002262726.1| PREDICTED: serine/threonine-protein kinase S... 69 1e-17 ref|XP_002517501.1| Serine/threonine-protein kinase SAPK3, putat... 73 3e-17 gb|AAD00240.1| PK11-C5 [Nicotiana tabacum] 68 8e-16 gb|AAC69450.1| putative serine/threonine protein kinase [Nicotia... 68 8e-16 >emb|CAN62023.1| hypothetical protein VITISV_005083 [Vitis vinifera] Length = 367 Score = 69.3 bits (168), Expect(2) = 1e-17 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = +2 Query: 2 LSQIFVSDPAKRITIPDIKKHPWFLKNLPRELLEVERTSYENIN 133 LS+IFV++PAKRITIP+IK+HPWFLKN P+EL+E E+T+Y ++ Sbjct: 238 LSRIFVANPAKRITIPEIKQHPWFLKNFPKELIEGEKTNYGELH 281 Score = 45.4 bits (106), Expect(2) = 1e-17 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +3 Query: 243 QSIEEITRIVQEAMIPAEGSKPSWQSMEGTLDHNYIEAE 359 QS+EEI RI+QEA P EGSK S++G LD + +EA+ Sbjct: 287 QSVEEIMRIIQEARTPGEGSKVDGHSLDGALDSDDLEAD 325 >ref|XP_002262726.1| PREDICTED: serine/threonine-protein kinase SAPK3 [Vitis vinifera] gi|296083436|emb|CBI23389.3| unnamed protein product [Vitis vinifera] Length = 340 Score = 69.3 bits (168), Expect(2) = 1e-17 Identities = 29/44 (65%), Positives = 40/44 (90%) Frame = +2 Query: 2 LSQIFVSDPAKRITIPDIKKHPWFLKNLPRELLEVERTSYENIN 133 LS+IFV++PAKRITIP+IK+HPWFLKN P+EL+E E+T+Y ++ Sbjct: 238 LSRIFVANPAKRITIPEIKQHPWFLKNFPKELIEGEKTNYGELH 281 Score = 45.4 bits (106), Expect(2) = 1e-17 Identities = 21/39 (53%), Positives = 28/39 (71%) Frame = +3 Query: 243 QSIEEITRIVQEAMIPAEGSKPSWQSMEGTLDHNYIEAE 359 QS+EEI RI+QEA P EGSK S++G LD + +EA+ Sbjct: 287 QSVEEIMRIIQEARTPGEGSKVDGHSLDGALDSDDLEAD 325 >ref|XP_002517501.1| Serine/threonine-protein kinase SAPK3, putative [Ricinus communis] gi|223543512|gb|EEF45043.1| Serine/threonine-protein kinase SAPK3, putative [Ricinus communis] Length = 336 Score = 73.2 bits (178), Expect(2) = 3e-17 Identities = 31/49 (63%), Positives = 43/49 (87%) Frame = +2 Query: 2 LSQIFVSDPAKRITIPDIKKHPWFLKNLPRELLEVERTSYENINIYEPT 148 LS+IFV++PAKRITIP+IK+HPWFLKNLP+EL+E+E+T+Y +P+ Sbjct: 238 LSRIFVANPAKRITIPEIKQHPWFLKNLPKELIEIEKTTYAESERDQPS 286 Score = 40.0 bits (92), Expect(2) = 3e-17 Identities = 19/34 (55%), Positives = 25/34 (73%) Frame = +3 Query: 237 PTQSIEEITRIVQEAMIPAEGSKPSWQSMEGTLD 338 P+QS+EEI RI+QEA P EG+K S ++ GT D Sbjct: 285 PSQSVEEIMRIIQEAKTPGEGAKFSELAVPGTSD 318 >gb|AAD00240.1| PK11-C5 [Nicotiana tabacum] Length = 339 Score = 67.8 bits (164), Expect(2) = 8e-16 Identities = 28/41 (68%), Positives = 38/41 (92%) Frame = +2 Query: 2 LSQIFVSDPAKRITIPDIKKHPWFLKNLPRELLEVERTSYE 124 LS+IFV++P+KRITIP+IKKHPWFLKNLP++L++ E + YE Sbjct: 238 LSRIFVANPSKRITIPEIKKHPWFLKNLPKDLMDGEHSKYE 278 Score = 40.4 bits (93), Expect(2) = 8e-16 Identities = 20/37 (54%), Positives = 25/37 (67%) Frame = +3 Query: 243 QSIEEITRIVQEAMIPAEGSKPSWQSMEGTLDHNYIE 353 QS+EEI RI+QEA IP E SKP Q+ E T + + E Sbjct: 286 QSVEEIMRIIQEAKIPGEVSKPEGQATERTTEQDDTE 322 >gb|AAC69450.1| putative serine/threonine protein kinase [Nicotiana tabacum] gi|4098172|gb|AAD00239.1| PK11-C1 [Nicotiana tabacum] Length = 339 Score = 67.8 bits (164), Expect(2) = 8e-16 Identities = 28/41 (68%), Positives = 38/41 (92%) Frame = +2 Query: 2 LSQIFVSDPAKRITIPDIKKHPWFLKNLPRELLEVERTSYE 124 LS+IFV++P+KRITIP+IKKHPWFLKNLP++L++ E + YE Sbjct: 238 LSRIFVANPSKRITIPEIKKHPWFLKNLPKDLMDGEHSKYE 278 Score = 40.4 bits (93), Expect(2) = 8e-16 Identities = 19/32 (59%), Positives = 23/32 (71%) Frame = +3 Query: 243 QSIEEITRIVQEAMIPAEGSKPSWQSMEGTLD 338 QS+EEI RI+QEA IP E SKP Q+ GT + Sbjct: 286 QSVEEIMRIIQEAKIPGEVSKPEGQATAGTAE 317