BLASTX nr result
ID: Coptis25_contig00010262
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010262 (550 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004145493.1| PREDICTED: phospholipid hydroperoxide glutat... 146 2e-33 gb|ADB85096.1| putative glutathione peroxidase [Jatropha curcas] 146 2e-33 gb|ACY76261.1| glutathione peroxidase, partial [Citrus reticulata] 145 4e-33 gb|AFF18780.1| glutathione peroxidase, partial [Dimocarpus longan] 144 7e-33 gb|AAC78466.1| glutathione peroxidase [Zantedeschia aethiopica] 144 9e-33 >ref|XP_004145493.1| PREDICTED: phospholipid hydroperoxide glutathione peroxidase 1, chloroplastic-like [Cucumis sativus] Length = 241 Score = 146 bits (368), Expect = 2e-33 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = -2 Query: 549 KAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 370 KAEFPIFDKVDVNGP+TAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS Sbjct: 168 KAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 227 Query: 369 PFQIEKDIQK 340 PFQIEKDIQK Sbjct: 228 PFQIEKDIQK 237 >gb|ADB85096.1| putative glutathione peroxidase [Jatropha curcas] Length = 234 Score = 146 bits (368), Expect = 2e-33 Identities = 69/70 (98%), Positives = 70/70 (100%) Frame = -2 Query: 549 KAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 370 KAEFPIFDKVDVNGP+TAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS Sbjct: 161 KAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 220 Query: 369 PFQIEKDIQK 340 PFQIEKDIQK Sbjct: 221 PFQIEKDIQK 230 >gb|ACY76261.1| glutathione peroxidase, partial [Citrus reticulata] Length = 132 Score = 145 bits (366), Expect = 4e-33 Identities = 67/70 (95%), Positives = 70/70 (100%) Frame = -2 Query: 549 KAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 370 KAEFPIFDKVDVNGP+TAPVYQFLKSSAGGFLGDL+KWNFEKFLVDKNGKV+ERYPPTTS Sbjct: 59 KAEFPIFDKVDVNGPNTAPVYQFLKSSAGGFLGDLVKWNFEKFLVDKNGKVIERYPPTTS 118 Query: 369 PFQIEKDIQK 340 PFQIEKDIQK Sbjct: 119 PFQIEKDIQK 128 >gb|AFF18780.1| glutathione peroxidase, partial [Dimocarpus longan] Length = 151 Score = 144 bits (364), Expect = 7e-33 Identities = 68/70 (97%), Positives = 70/70 (100%) Frame = -2 Query: 549 KAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 370 KAEFPIFDKV+VNGP+TAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS Sbjct: 78 KAEFPIFDKVEVNGPNTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 137 Query: 369 PFQIEKDIQK 340 PFQIEKDIQK Sbjct: 138 PFQIEKDIQK 147 >gb|AAC78466.1| glutathione peroxidase [Zantedeschia aethiopica] Length = 244 Score = 144 bits (363), Expect = 9e-33 Identities = 68/70 (97%), Positives = 69/70 (98%) Frame = -2 Query: 549 KAEFPIFDKVDVNGPSTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 370 KAEFPIFDKVDVNGP TAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS Sbjct: 171 KAEFPIFDKVDVNGPKTAPVYQFLKSSAGGFLGDLIKWNFEKFLVDKNGKVVERYPPTTS 230 Query: 369 PFQIEKDIQK 340 PFQIEKDI+K Sbjct: 231 PFQIEKDIRK 240