BLASTX nr result
ID: Coptis25_contig00010242
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010242 (662 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAA82062.1| eukaryotic release factor 3, partial [Ricinus com... 69 6e-10 ref|XP_002532529.1| eukaryotic peptide chain release factor GTP-... 69 6e-10 ref|XP_002329194.1| predicted protein [Populus trichocarpa] gi|2... 67 3e-09 gb|ABF48401.1| GTP-binding protein [Triticum aestivum] 66 7e-09 ref|XP_003579482.1| PREDICTED: eukaryotic peptide chain release ... 65 9e-09 >gb|AAA82062.1| eukaryotic release factor 3, partial [Ricinus communis] Length = 150 Score = 69.3 bits (168), Expect = 6e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 ICIEKFSDFPQLGRFTLRSEGKTIAVGKVTALPSLGGS 115 ICIEKFSDFPQLGRFTLR+EGKT+AVGKVT LP+ G S Sbjct: 112 ICIEKFSDFPQLGRFTLRTEGKTVAVGKVTELPTSGSS 149 >ref|XP_002532529.1| eukaryotic peptide chain release factor GTP-binding subunit, putative [Ricinus communis] gi|223527760|gb|EEF29863.1| eukaryotic peptide chain release factor GTP-binding subunit, putative [Ricinus communis] Length = 497 Score = 69.3 bits (168), Expect = 6e-10 Identities = 32/38 (84%), Positives = 35/38 (92%) Frame = +2 Query: 2 ICIEKFSDFPQLGRFTLRSEGKTIAVGKVTALPSLGGS 115 ICIEKFSDFPQLGRFTLR+EGKT+AVGKVT LP+ G S Sbjct: 459 ICIEKFSDFPQLGRFTLRTEGKTVAVGKVTELPTSGSS 496 >ref|XP_002329194.1| predicted protein [Populus trichocarpa] gi|222870975|gb|EEF08106.1| predicted protein [Populus trichocarpa] Length = 524 Score = 67.0 bits (162), Expect = 3e-09 Identities = 30/34 (88%), Positives = 33/34 (97%) Frame = +2 Query: 2 ICIEKFSDFPQLGRFTLRSEGKTIAVGKVTALPS 103 IC+EKFSDFPQLGRFTLR+EGKT+AVGKVT LPS Sbjct: 487 ICVEKFSDFPQLGRFTLRTEGKTVAVGKVTELPS 520 >gb|ABF48401.1| GTP-binding protein [Triticum aestivum] Length = 533 Score = 65.9 bits (159), Expect = 7e-09 Identities = 31/38 (81%), Positives = 34/38 (89%) Frame = +2 Query: 2 ICIEKFSDFPQLGRFTLRSEGKTIAVGKVTALPSLGGS 115 ICIEKFSDFPQLGRFTLR+EGKTIAVGKV +P +G S Sbjct: 492 ICIEKFSDFPQLGRFTLRTEGKTIAVGKVVDVPPVGRS 529 >ref|XP_003579482.1| PREDICTED: eukaryotic peptide chain release factor GTP-binding subunit ERF3A-like [Brachypodium distachyon] Length = 543 Score = 65.5 bits (158), Expect = 9e-09 Identities = 29/38 (76%), Positives = 34/38 (89%) Frame = +2 Query: 2 ICIEKFSDFPQLGRFTLRSEGKTIAVGKVTALPSLGGS 115 ICIEKFSDFPQLGRFTLR+EGKT+AVGKV +P +G + Sbjct: 502 ICIEKFSDFPQLGRFTLRTEGKTVAVGKVVDVPPIGST 539