BLASTX nr result
ID: Coptis25_contig00010158
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010158 (248 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI27954.3| unnamed protein product [Vitis vinifera] 103 6e-24 emb|CAN62001.1| hypothetical protein VITISV_007878 [Vitis vinifera] 103 6e-24 ref|XP_002282963.1| PREDICTED: probable zinc protease pqqL-like ... 103 6e-24 ref|XP_002455798.1| hypothetical protein SORBIDRAFT_03g025400 [S... 99 9e-23 tpg|DAA59000.1| TPA: hypothetical protein ZEAMMB73_046584 [Zea m... 99 9e-23 >emb|CBI27954.3| unnamed protein product [Vitis vinifera] Length = 1009 Score = 103 bits (256), Expect(2) = 6e-24 Identities = 46/61 (75%), Positives = 58/61 (95%) Frame = -1 Query: 185 KKKLKIVMETAEEAIHAQERDPHSAFANRVRELNYGNSYFFVPIKISNLRRVDPRKACEY 6 ++++KIVM+ AEEA+HAQERDP++AFANRVRELNYGNSYFF PI+IS+LR+VDP KAC+Y Sbjct: 639 EEEVKIVMQMAEEAVHAQERDPYTAFANRVRELNYGNSYFFRPIRISDLRKVDPLKACQY 698 Query: 5 F 3 F Sbjct: 699 F 699 Score = 32.3 bits (72), Expect(2) = 6e-24 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 247 DLETGLQVVYRLFTTDVVP 191 DLET LQ+VY+LFTT+V P Sbjct: 619 DLETALQLVYQLFTTNVKP 637 >emb|CAN62001.1| hypothetical protein VITISV_007878 [Vitis vinifera] Length = 981 Score = 103 bits (256), Expect(2) = 6e-24 Identities = 46/61 (75%), Positives = 58/61 (95%) Frame = -1 Query: 185 KKKLKIVMETAEEAIHAQERDPHSAFANRVRELNYGNSYFFVPIKISNLRRVDPRKACEY 6 ++++KIVM+ AEEA+HAQERDP++AFANRVRELNYGNSYFF PI+IS+LR+VDP KAC+Y Sbjct: 611 EEEVKIVMQMAEEAVHAQERDPYTAFANRVRELNYGNSYFFRPIRISDLRKVDPLKACQY 670 Query: 5 F 3 F Sbjct: 671 F 671 Score = 32.3 bits (72), Expect(2) = 6e-24 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 247 DLETGLQVVYRLFTTDVVP 191 DLET LQ+VY+LFTT+V P Sbjct: 591 DLETALQLVYQLFTTNVKP 609 >ref|XP_002282963.1| PREDICTED: probable zinc protease pqqL-like [Vitis vinifera] Length = 957 Score = 103 bits (256), Expect(2) = 6e-24 Identities = 46/61 (75%), Positives = 58/61 (95%) Frame = -1 Query: 185 KKKLKIVMETAEEAIHAQERDPHSAFANRVRELNYGNSYFFVPIKISNLRRVDPRKACEY 6 ++++KIVM+ AEEA+HAQERDP++AFANRVRELNYGNSYFF PI+IS+LR+VDP KAC+Y Sbjct: 587 EEEVKIVMQMAEEAVHAQERDPYTAFANRVRELNYGNSYFFRPIRISDLRKVDPLKACQY 646 Query: 5 F 3 F Sbjct: 647 F 647 Score = 32.3 bits (72), Expect(2) = 6e-24 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 247 DLETGLQVVYRLFTTDVVP 191 DLET LQ+VY+LFTT+V P Sbjct: 567 DLETALQLVYQLFTTNVKP 585 >ref|XP_002455798.1| hypothetical protein SORBIDRAFT_03g025400 [Sorghum bicolor] gi|241927773|gb|EES00918.1| hypothetical protein SORBIDRAFT_03g025400 [Sorghum bicolor] Length = 978 Score = 99.4 bits (246), Expect(2) = 9e-23 Identities = 44/61 (72%), Positives = 58/61 (95%) Frame = -1 Query: 185 KKKLKIVMETAEEAIHAQERDPHSAFANRVRELNYGNSYFFVPIKISNLRRVDPRKACEY 6 ++++KIVM+ AEEAI+AQERDP++AFANRVRE+NYGNSYFF PI+IS+L++VDP +ACEY Sbjct: 608 EEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSYFFKPIRISDLKKVDPIRACEY 667 Query: 5 F 3 F Sbjct: 668 F 668 Score = 32.3 bits (72), Expect(2) = 9e-23 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 247 DLETGLQVVYRLFTTDVVP 191 DLET LQ+VY+LFTT+V P Sbjct: 588 DLETALQLVYQLFTTNVEP 606 >tpg|DAA59000.1| TPA: hypothetical protein ZEAMMB73_046584 [Zea mays] Length = 939 Score = 99.4 bits (246), Expect(2) = 9e-23 Identities = 44/61 (72%), Positives = 58/61 (95%) Frame = -1 Query: 185 KKKLKIVMETAEEAIHAQERDPHSAFANRVRELNYGNSYFFVPIKISNLRRVDPRKACEY 6 ++++KIVM+ AEEAI+AQERDP++AFANRVRE+NYGNSYFF PI+IS+L++VDP +ACEY Sbjct: 556 EEEVKIVMQMAEEAIYAQERDPYTAFANRVREINYGNSYFFKPIRISDLKKVDPIRACEY 615 Query: 5 F 3 F Sbjct: 616 F 616 Score = 32.3 bits (72), Expect(2) = 9e-23 Identities = 14/19 (73%), Positives = 17/19 (89%) Frame = -2 Query: 247 DLETGLQVVYRLFTTDVVP 191 DLET LQ+VY+LFTT+V P Sbjct: 536 DLETALQLVYQLFTTNVEP 554