BLASTX nr result
ID: Coptis25_contig00010048
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010048 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AAM62868.1| citrate synthase [Arabidopsis thaliana] 62 5e-08 gb|ACU42176.1| citrate synthase [Citrus sinensis] 61 1e-07 gb|AAR88248.1| mitochondrial citrate synthase precursor [Citrus ... 61 1e-07 ref|NP_566016.1| citrate synthase 4 [Arabidopsis thaliana] gi|14... 60 2e-07 gb|ADZ05826.1| citrate synthase [Citrus maxima] 60 2e-07 >gb|AAM62868.1| citrate synthase [Arabidopsis thaliana] Length = 473 Score = 62.0 bits (149), Expect = 5e-08 Identities = 29/41 (70%), Positives = 35/41 (85%) Frame = +3 Query: 225 MVFFRTVCALSNLRSRVAQQSTFNTSVRWLQMQSSSELDLK 347 MVFFR+V A + LRSRV QQS+ N SVRW+QMQSS++LDLK Sbjct: 1 MVFFRSVSAFTRLRSRVGQQSSLNNSVRWIQMQSSTDLDLK 41 >gb|ACU42176.1| citrate synthase [Citrus sinensis] Length = 471 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +3 Query: 225 MVFFRTVCALSNLRSRVAQQSTFNTSVRWLQMQSSSELDL 344 M FFR+V ALS LRSRV QQS + SVRWLQMQSSS+LDL Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDL 40 >gb|AAR88248.1| mitochondrial citrate synthase precursor [Citrus junos] Length = 464 Score = 60.8 bits (146), Expect = 1e-07 Identities = 30/40 (75%), Positives = 33/40 (82%) Frame = +3 Query: 225 MVFFRTVCALSNLRSRVAQQSTFNTSVRWLQMQSSSELDL 344 M FFR+V ALS LRSRV QQS + SVRWLQMQSSS+LDL Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSSDLDL 40 >ref|NP_566016.1| citrate synthase 4 [Arabidopsis thaliana] gi|14423562|gb|AAK62463.1|AF387018_1 citrate synthase [Arabidopsis thaliana] gi|20197191|gb|AAC16084.2| citrate synthase [Arabidopsis thaliana] gi|30387583|gb|AAP31957.1| At2g44350 [Arabidopsis thaliana] gi|330255316|gb|AEC10410.1| citrate synthase 4 [Arabidopsis thaliana] Length = 473 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/41 (68%), Positives = 35/41 (85%) Frame = +3 Query: 225 MVFFRTVCALSNLRSRVAQQSTFNTSVRWLQMQSSSELDLK 347 MVFFR+V A + LRSRV QQS+ + SVRW+QMQSS++LDLK Sbjct: 1 MVFFRSVSAFTRLRSRVGQQSSLSNSVRWIQMQSSTDLDLK 41 >gb|ADZ05826.1| citrate synthase [Citrus maxima] Length = 471 Score = 59.7 bits (143), Expect = 2e-07 Identities = 29/40 (72%), Positives = 33/40 (82%) Frame = +3 Query: 225 MVFFRTVCALSNLRSRVAQQSTFNTSVRWLQMQSSSELDL 344 M FFR+V ALS LRSRV QQS + SVRWLQMQSS++LDL Sbjct: 1 MAFFRSVTALSRLRSRVGQQSNLSNSVRWLQMQSSADLDL 40