BLASTX nr result
ID: Coptis25_contig00010001
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00010001 (849 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002521001.1| Protein mrp, putative [Ricinus communis] gi|... 71 3e-10 ref|XP_003536923.1| PREDICTED: iron-sulfur protein NUBPL-like [G... 69 1e-09 ref|XP_002307635.1| predicted protein [Populus trichocarpa] gi|2... 69 2e-09 ref|XP_002300792.1| predicted protein [Populus trichocarpa] gi|2... 69 2e-09 gb|ACG34330.1| nucleotide-binding protein-like [Zea mays] 68 2e-09 >ref|XP_002521001.1| Protein mrp, putative [Ricinus communis] gi|223539838|gb|EEF41418.1| Protein mrp, putative [Ricinus communis] Length = 293 Score = 71.2 bits (173), Expect = 3e-10 Identities = 31/34 (91%), Positives = 33/34 (97%) Frame = -2 Query: 104 AEMKMVPIENYGVKCMSIGFLVEKDAPIVWRGPM 3 A+ KM+PIENYGVKCMSIGFLVEKDAPIVWRGPM Sbjct: 91 ADTKMIPIENYGVKCMSIGFLVEKDAPIVWRGPM 124 >ref|XP_003536923.1| PREDICTED: iron-sulfur protein NUBPL-like [Glycine max] Length = 277 Score = 68.9 bits (167), Expect = 1e-09 Identities = 28/33 (84%), Positives = 32/33 (96%) Frame = -2 Query: 101 EMKMVPIENYGVKCMSIGFLVEKDAPIVWRGPM 3 + KM+P+ENYG+KCMSIGFLVEKDAPIVWRGPM Sbjct: 80 DKKMIPVENYGIKCMSIGFLVEKDAPIVWRGPM 112 >ref|XP_002307635.1| predicted protein [Populus trichocarpa] gi|222857084|gb|EEE94631.1| predicted protein [Populus trichocarpa] Length = 293 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 101 EMKMVPIENYGVKCMSIGFLVEKDAPIVWRGPM 3 + KM+PIENYGVKCMS+GFLVEKDAPIVWRGPM Sbjct: 92 DKKMIPIENYGVKCMSMGFLVEKDAPIVWRGPM 124 >ref|XP_002300792.1| predicted protein [Populus trichocarpa] gi|222842518|gb|EEE80065.1| predicted protein [Populus trichocarpa] Length = 260 Score = 68.6 bits (166), Expect = 2e-09 Identities = 29/33 (87%), Positives = 32/33 (96%) Frame = -2 Query: 101 EMKMVPIENYGVKCMSIGFLVEKDAPIVWRGPM 3 + KM+PIENYGVKCMS+GFLVEKDAPIVWRGPM Sbjct: 71 DKKMIPIENYGVKCMSMGFLVEKDAPIVWRGPM 103 >gb|ACG34330.1| nucleotide-binding protein-like [Zea mays] Length = 214 Score = 68.2 bits (165), Expect = 2e-09 Identities = 29/36 (80%), Positives = 34/36 (94%) Frame = -2 Query: 110 LLAEMKMVPIENYGVKCMSIGFLVEKDAPIVWRGPM 3 L +MKM+PIEN+GV+CMSIGFLV+KDAPIVWRGPM Sbjct: 10 LSEDMKMIPIENHGVRCMSIGFLVDKDAPIVWRGPM 45