BLASTX nr result
ID: Coptis25_contig00004746
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00004746 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_671779.1| Aminotransferase-like, plant mobile domain fami... 55 6e-06 >ref|NP_671779.1| Aminotransferase-like, plant mobile domain family protein [Arabidopsis thaliana] gi|330250784|gb|AEC05878.1| Aminotransferase-like, plant mobile domain family protein [Arabidopsis thaliana] Length = 667 Score = 55.1 bits (131), Expect = 6e-06 Identities = 32/84 (38%), Positives = 44/84 (52%) Frame = -1 Query: 254 DYAVHVAHDIWERRKDCGALKCVSHLAKLSQWDFKNECERSSRFAQQLRRTGLFDLVEGY 75 D HV+ +W+ ++ GAL+C H +KL +W K + + + R G L Sbjct: 17 DQEKHVSSAVWDGQER-GALRCHEHTSKLGEWKLK------PKQIELVERAGFGFLRRIP 69 Query: 74 HEHMDPPLISAFVERWHPETNTFH 3 +D PLISA VERW ETNTFH Sbjct: 70 AISLDNPLISALVERWRRETNTFH 93