BLASTX nr result
ID: Coptis25_contig00002693
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00002693 (991 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] 74 4e-11 ref|YP_588418.1| hypothetical protein ZeamMp173 [Zea mays subsp.... 69 1e-09 gb|AFW62556.1| hypothetical protein ZEAMMB73_728251 [Zea mays] 67 5e-09 >emb|CAN73973.1| hypothetical protein VITISV_023797 [Vitis vinifera] Length = 291 Score = 74.3 bits (181), Expect = 4e-11 Identities = 36/47 (76%), Positives = 37/47 (78%), Gaps = 3/47 (6%) Frame = +1 Query: 496 WH---LSLIHSARPDAAPFLIIIYRPFFPPGYSRMKIVVCMLDFGCK 627 WH S I AR DAA F IIIYRPFFPPGYSRMKIVVCMLDFGC+ Sbjct: 140 WHGTFRSSIPPARQDAASFFIIIYRPFFPPGYSRMKIVVCMLDFGCR 186 >ref|YP_588418.1| hypothetical protein ZeamMp173 [Zea mays subsp. mays] gi|40795085|gb|AAR91129.1| hypothetical protein (mitochondrion) [Zea mays] Length = 117 Score = 69.3 bits (168), Expect = 1e-09 Identities = 32/39 (82%), Positives = 33/39 (84%) Frame = +1 Query: 511 IHSARPDAAPFLIIIYRPFFPPGYSRMKIVVCMLDFGCK 627 I ARPDAAPF IIIYRPFFPP SRMKIVVCM DFGC+ Sbjct: 45 IKPARPDAAPFRIIIYRPFFPPVPSRMKIVVCMFDFGCR 83 >gb|AFW62556.1| hypothetical protein ZEAMMB73_728251 [Zea mays] Length = 137 Score = 67.4 bits (163), Expect = 5e-09 Identities = 30/39 (76%), Positives = 32/39 (82%) Frame = +1 Query: 511 IHSARPDAAPFLIIIYRPFFPPGYSRMKIVVCMLDFGCK 627 I ARPDA PF IIIYRPFFPP SRMKIV+CM DFGC+ Sbjct: 45 IKPARPDAVPFRIIIYRPFFPPVPSRMKIVICMFDFGCR 83