BLASTX nr result
ID: Coptis25_contig00001411
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis25_contig00001411 (369 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002277561.1| PREDICTED: UPF0057 membrane protein At4g3065... 72 4e-11 gb|AAV35467.1| cold and salt response protein [Brassica napus] 62 4e-08 gb|AAT11798.1| salt and low temperature response protein [Brassi... 62 4e-08 ref|NP_194794.1| putative low temperature and salt responsive pr... 61 1e-07 gb|AFX67002.1| hydrophobic protein OSR8 [Solanum tuberosum] 60 2e-07 >ref|XP_002277561.1| PREDICTED: UPF0057 membrane protein At4g30650 [Vitis vinifera] gi|147791950|emb|CAN64139.1| hypothetical protein VITISV_004807 [Vitis vinifera] gi|147805308|emb|CAN73911.1| hypothetical protein VITISV_002031 [Vitis vinifera] gi|297743660|emb|CBI36543.3| unnamed protein product [Vitis vinifera] Length = 72 Score = 72.4 bits (176), Expect = 4e-11 Identities = 32/42 (76%), Positives = 38/42 (90%) Frame = -1 Query: 369 VEFLICLLLTILGYIPGIIYALYVIVAVNKEPEPDYWRPINA 244 VEF ICLLLT+LGYIPGIIYALYVIV V+++P+ YWRP+NA Sbjct: 31 VEFCICLLLTLLGYIPGIIYALYVIVFVDRDPDDYYWRPLNA 72 >gb|AAV35467.1| cold and salt response protein [Brassica napus] Length = 74 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 369 VEFLICLLLTILGYIPGIIYALYVIVAVNKEPE-PDYWRPINA 244 VEFLICL+LTILGYIPGIIYALYVIV N+E E DY P+N+ Sbjct: 31 VEFLICLVLTILGYIPGIIYALYVIVFQNREGETQDYSAPLNS 73 >gb|AAT11798.1| salt and low temperature response protein [Brassica rapa subsp. pekinensis] Length = 74 Score = 62.4 bits (150), Expect = 4e-08 Identities = 32/43 (74%), Positives = 36/43 (83%), Gaps = 1/43 (2%) Frame = -1 Query: 369 VEFLICLLLTILGYIPGIIYALYVIVAVNKEPE-PDYWRPINA 244 VEFLICL+LTILGYIPGIIYALYVIV N+E E DY P+N+ Sbjct: 31 VEFLICLVLTILGYIPGIIYALYVIVFQNREGETQDYSAPLNS 73 >ref|NP_194794.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] gi|15214227|sp|Q9M095.1|RC23_ARATH RecName: Full=UPF0057 membrane protein At4g30650 gi|7269966|emb|CAB79783.1| low temperature and salt responsive protein homolog [Arabidopsis thaliana] gi|38566502|gb|AAR24141.1| At4g30650 [Arabidopsis thaliana] gi|40823676|gb|AAR92298.1| At4g30650 [Arabidopsis thaliana] gi|225898833|dbj|BAH30547.1| hypothetical protein [Arabidopsis thaliana] gi|332660390|gb|AEE85790.1| putative low temperature and salt responsive protein [Arabidopsis thaliana] Length = 73 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/42 (69%), Positives = 34/42 (80%) Frame = -1 Query: 369 VEFLICLLLTILGYIPGIIYALYVIVAVNKEPEPDYWRPINA 244 VEFLICL+LTILGYIPGIIYALYVIV N+E + P+N+ Sbjct: 31 VEFLICLVLTILGYIPGIIYALYVIVFQNREGSTELGAPLNS 72 >gb|AFX67002.1| hydrophobic protein OSR8 [Solanum tuberosum] Length = 71 Score = 60.1 bits (144), Expect = 2e-07 Identities = 26/37 (70%), Positives = 32/37 (86%) Frame = -1 Query: 369 VEFLICLLLTILGYIPGIIYALYVIVAVNKEPEPDYW 259 VEFLICL+LTILGY+PGIIYALY I+ V +EP D++ Sbjct: 31 VEFLICLVLTILGYVPGIIYALYAILCVEREPRVDHY 67